KEGG   Nectria haematococca: NECHADRAFT_71857Help
Entry
NECHADRAFT_71857  CDS       T01612                                 

Definition
(RefSeq) glycosyltransferase family 3
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
nhe  Nectria haematococca
Pathway
nhe00500  Starch and sucrose metabolism
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NECHADRAFT_71857
Enzymes [BR:nhe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     NECHADRAFT_71857
Glycosyltransferases [BR:nhe01003]
 Polysaccharide
  Storage polysaccharide
   NECHADRAFT_71857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 9674840
NCBI-ProteinID: XP_003050444
JGI: 71857
UniProt: C7YU30
Position
9
AA seq 708 aa AA seqDB search
MSSEGEQQTRDIKNHLLFEIATEVAHRVGGIYSVIKSKAPVTTAEYGERYTLIGPLNHQS
AAVEVEEMEPTSPEIAATMQSMKDRGIGIIYGRWLIEGAPRVILIDTKTAYNRMNEWKSD
LWELASIPSPPNDDETNEAIIFGYLVAWFLGEFVCHERKKAVIAHFHEWLAGVALPLCKK
RRIDVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERAATHACD
VFTTVSHITAFESEHLLKRKPDGVLPNGLNVTKFSAVHEFQNLHQQAKEKIHDFVRGHFY
GHYDFEPDNTLYLFTAGRYEFRNKGVDMFIESLARLNHRLKAAGSKVTVVAFIIMPAQTT
SLTVEALKGQAVIKSLRDTTHVIEQSIGRRIFERSLKWHEGDPMPDEKELISAQDRVLLR
RRLFAMKRHGLPPIVTHNMVNDHEDPVLNQIRRVQLFNHPSDRVKVVFHPEFLNSANPVL
PLDYDDFVRGCHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYG
IYIVDRRTKGVDDSVNQLTSFMFDFCAKSRRQRINQRNRTERLSDLLDWKRMGMEYVKAR
QLALRRAYPNSFSGDEEEDDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQEGREG
LNTEDYVAWKLPEEEDPEEYPFPLTLRTKQPGPPSPLEGASAPVNGSQ
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgagttccgaaggcgagcagcagactcgcgacatcaagaaccaccttctctttgagatt
gctactgaggtagcccatcgagttggtggtatctactctgtcatcaaatccaaggccccc
gtcacaacagctgaatatggcgagcgatacactctcatcggccctcttaaccaccaatcg
gctgctgtcgaggtggaagagatggagcccaccagcccagagattgctgccaccatgcag
tccatgaaggaccggggaattggcatcatctacggccgctggctgatcgagggcgcgcct
agggttatcctcatcgacaccaagaccgcctataaccggatgaatgagtggaagtcggat
ctgtgggaactggccagtatcccttcgccacccaacgacgacgagaccaacgaggctatc
attttcggttatcttgtcgcctggttcctgggagagtttgtctgtcacgagaggaagaag
gctgtcattgctcacttccacgagtggcttgctggtgtcgccctgcccctctgcaagaag
cgccgcattgatgtcacgaccatcttcaccacacacgccacccttctcggccgatacctc
tgcgccggctccgtggacttttacaacaacctgcagtactttgacgttgacgccgaggcc
ggcaagcgtggcatctaccaccgatactgcatcgagagagctgccactcacgcctgcgat
gtcttcactaccgtctctcacatcaccgccttcgagtccgagcacttgctgaagcgaaag
cctgatggcgttctgcccaacggtctcaacgtcaccaagttctctgccgtccacgaattc
caaaacctccaccagcaagctaaagagaagatccacgactttgttcgaggtcacttctac
ggccactatgactttgaacccgacaacactctgtacctctttactgcaggccgttacgag
ttccggaataagggcgttgacatgttcatcgagtctctggcacggctgaaccaccggctc
aaggccgcgggaagtaaggtgaccgtggtggcctttatcatcatgcccgcccaaaccacg
tctctcaccgtggaagcgctcaaggggcaggcagtcatcaagtccctgagggatacgacg
cacgtcattgagcagagcattggacgccgcatctttgagcgctcgctcaaatggcacgag
ggcgaccccatgcctgatgagaaggagctcatttctgcccaggaccgagtcctgcttcgt
cgccgtctgtttgccatgaagcgccacggacttcctcctatcgtcacccataacatggtc
aacgatcacgaggatcccgtcctgaaccagatccgacgagtccagctcttcaaccaccct
tcggaccgagtcaaggtggtgttccaccccgagttcctcaactcggccaacccagtcctt
cctctcgactacgacgactttgtgcgcggttgccacttgggtgtcttctcgtcctactat
gagccctggggttacactcccgccgagtgcactgtgatgggtgttcccagcatcaccaca
aacctgtcaggtttcggatgttacatggaggagcttattgagaactccagcgactacggt
atctacattgtggaccgacgtaccaagggtgttgacgactctgtcaaccagctcacctcg
ttcatgttcgacttctgcgccaagagccgccgtcagcgcatcaaccagcgaaaccgaact
gagcgactcagcgaccttctcgactggaagcggatgggtatggagtatgtcaaggctcgg
cagttggctcttcgccgtgcctaccccaactcgttcagcggcgacgaggaggaggacgac
ttcatccctggcgtggagcagaagatttcgcggccattctctgttcccggctcgcctcgg
gatcggactggcatgatgactcctggtgactttgccagcctgcaggagggccgtgagggt
ctgaacactgaggactatgttgcctggaagctacctgaggaggaggaccctgaggagtat
cccttccctttgactctcaggaccaagcaacccggcccccctagtcctctggaaggtgca
agcgcccctgtgaacggtagccagtag

DBGET integrated database retrieval system