KEGG   Nectria haematococca: NECHADRAFT_73140Help
Entry
NECHADRAFT_73140  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NECHADRAFT_73140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 239 aa AA seqDB search
MAWRCTGSSNEALIDNMWRSGLITDARVKEAFLKVDRAHYAPSMPYEDSPQPIGHSATIS
APHMHASAIEHCLAYLIPSSISPSPRVLDIGSGSGYLTHVMAELVGEKGLVVGLEHIREL
KELGEHNMAKSPEGRKFLESGKVKFRLGDGRKGWVEEPREGEQDEGKGWDVIHVGASAVE
IHPELLEQLKAPGCMFIPVDDDGMGHSQHVWRIEKDGNGEITRKKLFGVRYVPLTNAPK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcttggagatgtaccggttccagcaacgaggcgctcatcgacaatatgtggaggagc
gggctcattactgatgctcgtgtcaaggaagcctttctcaaggttgatcgtgcgcattat
gctccgtcaatgccatacgaagattctccccaacctatcggccactctgccaccatatct
gctcctcacatgcacgcctcagccatcgaacattgtctcgcatacttaatcccctcctca
atctctccatcaccacgcgtcctcgatatcggctccgggtcgggatatttgacacatgta
atggctgaactagtcggcgaaaagggcctcgtggtgggactagagcatattagggaatta
aaagaactaggggaacataacatggcaaagagtccagaagggagaaagtttcttgagagt
ggcaaagtcaagtttaggttgggcgatgggaggaagggatgggttgaagaaccaagagaa
ggggaacaggacgaaggaaaggggtgggatgttattcacgtcggagcttcggcggttgag
atacatccggaattgctagagcagttaaaagcgcctggatgcatgtttattcccgtggat
gacgatgggatgggacatagccagcacgtctggcggatcgaaaaggacgggaatggggaa
attacaaggaagaagttgtttggcgttcgatatgtacccttgacgaatgcgccaaagtag

DBGET integrated database retrieval system