KEGG   Nectria haematococca: NECHADRAFT_73875Help
Entry
NECHADRAFT_73875  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nhe  Nectria haematococca
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:nhe00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:nhe00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 171 aa AA seqDB search
MASATSFYDFKPLDKRGQEVPLADYKGKVVLIVNTASKCGFTPQYEGLEKLWTDLKQKHP
DDFVILGFPCNQFGGQEPGSDEEIQSFCQINYGVSFPIMQKTEVNGDGTNPLWAWLKEQQ
PGLLGLKRVKWNFEKFLVGRDGKVKGRWASTTKPESLEKPILEALAEEVKA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgctaccagcttctacgactttaagccgcttgacaagcgcggccaagaggtt
cccctggccgactacaagggcaaggtcgtcctcatcgtcaacactgcctccaagtgcggc
ttcacccctcagtacgagggcctggagaagctctggaccgacctcaagcagaagcaccct
gatgactttgtcatcctcggcttcccctgcaaccagttcggcggccaggagcccgggtcc
gacgaggagattcagagcttctgccagatcaactacggcgtcagcttccccatcatgcaa
aagaccgaggtcaacggcgacggcaccaaccctctctgggcctggctcaaggagcagcag
cccggtcttctgggtctcaagcgcgtcaagtggaactttgaaaagttcctcgtcggacga
gacggaaaggtcaagggccgctgggctagcaccaccaagcccgagtccctcgagaagccc
atcctcgaggctctcgctgaggaggtcaaggcttga

DBGET integrated database retrieval system