KEGG   Nectria haematococca: NECHADRAFT_74011Help
Entry
NECHADRAFT_74011  CDS       T01612                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nhe  Nectria haematococca
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NECHADRAFT_74011
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NECHADRAFT_74011
   00620 Pyruvate metabolism
    NECHADRAFT_74011
   00640 Propanoate metabolism
    NECHADRAFT_74011
  Energy metabolism
   00680 Methane metabolism
    NECHADRAFT_74011
Enzymes [BR:nhe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NECHADRAFT_74011
Lipid biosynthesis proteins [BR:nhe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NECHADRAFT_74011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 665 aa AA seqDB search
MGEVLETQTAPVGGSEAEEWYLPDKMLARHPGRPHIAGLDEYRQMHQLSIQDPDTFWGQQ
ARDLLSWETDFHTVQHGSLSEGNVGWFLGGKLNASFNCVDRHALKDPNKVAIIHETDDGH
GGHSVTYGELLKQVSKVSWVLKDLGVRKGDTVAIYMPMVPEALVAILACARIGAVHSVVF
AGFSAGSLRDRITDAKSKVVITADESQRGGKTIGIKKIVDEALSPLEGVQTLVFKRTGAE
VGWVSDRDHWWHEEVKKWPSYIPPVSMDAEDPLFLLYTSGSTGKPKGILHTTGGYLVGAA
ATGKYVFDIHGDDRYFCAGDVGWITGHTYVVYAPLLLGVSTVVFEGTPTYPSINRYWDII
ANHKITHFYVAPTALRLLKRAGSDPVDHDTSSLRVLGSVGEPIAPEIWKWYFDTIGKGEC
HVVDTYWQTETGSHAVTPLAGVTPTKPGSACLPFFGIDTVLIDPVSGEEIHGNGVEGVLA
FKSSWPSMARTVYGDHQRFQETYLDVYKGYYFTGDGASRDQDGFYWIRGRVDDVINVSGH
RLSTAEIEAAMVEHSAVAESAVVGIADELTGQSVVAFVCLKEAFRANEEAIHLELRLQVR
KNIGPFAAPKNIFVVTDLPKTRSGKIMRRVLRKVVMGEQDQLGDVTTLSDPSVVGKIIDV
VHKGE
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaggtattggaaactcagacggcgcctgttggcggtagtgaggccgaggaatgg
tatcttcctgataagatgcttgccagacaccctggcaggcctcacattgctggcctcgat
gagtatcgtcagatgcaccagctctccatccaggatcctgataccttttggggacaacag
gctcgagatcttctctcctgggagactgactttcacaccgtccagcatggatccttgtcc
gagggcaacgttggctggttccttggaggcaagctgaacgcatccttcaactgcgtggat
cgacacgccctcaaggaccccaataaggttgctataattcacgaaactgatgatggacat
ggcggccactcggtgacttatggagagctgctgaagcaggtgagcaaggtttcttgggtt
cttaaggatctgggtgtgcgaaagggcgataccgtcgctatctacatgcctatggttcct
gaggccttggttgccattcttgcctgtgctcgcattggcgcagttcactccgtcgtcttc
gctggcttttctgccggatctcttcgagatcgcatcaccgacgccaagagcaaggtcgtc
atcacagccgacgaaagtcagcgaggcggcaagactatcggcatcaagaagattgtcgat
gaggccctaagcccccttgagggtgtccagactttggtcttcaagcggactggtgccgag
gttggctgggtttccgaccgagaccactggtggcatgaagaggtcaagaagtggcctagt
tatatccctcccgtttccatggacgcagaggatccccttttccttctgtatacgtctgga
tccacgggcaagccaaagggtatcttgcatactaccggcggctatctcgtaggagctgcg
gccactggcaagtatgtgttcgacattcacggagatgaccgctatttctgtgctggcgat
gtcggatggattactggccacacctatgttgtttatgcccctctgctcctgggcgtgtcc
accgtcgttttcgagggcacacccacatacccttccatcaaccgctactgggacattatc
gccaaccacaagattacgcacttctacgttgcgcccactgctcttcgacttctgaagaga
gctggatcggatcctgttgaccacgacaccagcagcctccgcgtccttggttcagtcgga
gagcctatcgctcctgagatttggaagtggtatttcgataccattggcaagggtgaatgt
cacgttgttgatacgtactggcaaactgagactggatctcatgctgttacgcccctcgct
ggtgtgacgcctaccaagcccggatctgcttgtttgcccttctttggtatcgatactgtc
ttgatcgaccccgtttctggtgaggaaattcatggaaatggagtcgagggtgtgcttgct
ttcaagtcttcttggcctagcatggctcgaacagtgtacggtgatcaccaaagattccag
gagacatatctggacgtttacaaggggtactatttcaccggtgatggtgctagccgtgat
caggatggcttttactggattcgcggccgcgttgacgatgtcatcaacgtcagcggccat
cgattatccactgctgagatcgaagctgccatggtcgagcactccgcggtcgctgagtct
gccgttgtcggtatcgccgacgagctcactggtcagtccgtggtggcttttgtctgcctc
aaggaggccttcagggccaatgaggaagccattcatcttgaactcaggctgcaagttcga
aagaacattggtcctttcgcggcccctaagaacatctttgtggttactgatctccccaag
actcgatctggaaagatcatgcgtcgtgttctgcgcaaggttgtcatgggcgagcaggat
cagcttggagatgtaactaccctgtcggatccctccgttgttggaaagatcatcgacgtt
gtgcacaagggggagtag

DBGET integrated database retrieval system