KEGG   Nectria haematococca: NECHADRAFT_74229Help
Entry
NECHADRAFT_74229  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
nhe  Nectria haematococca
Pathway
nhe00220  Arginine biosynthesis
nhe00330  Arginine and proline metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01130  Biosynthesis of antibiotics
nhe01230  Biosynthesis of amino acids
Module
nhe_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    NECHADRAFT_74229
   00330 Arginine and proline metabolism
    NECHADRAFT_74229
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     NECHADRAFT_74229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase DALR_2
Motif
Other DBs
NCBI-GeneID: 9677213
NCBI-ProteinID: XP_003049638
JGI: 74229
UniProt: C7YW97
Position
1
AA seq 300 aa AA seqDB search
MPPSTSITVIYSPYHLGARDVAVGGGPTALLKAGFIDAICKQGVTVRQIELEPVDEYEGD
IGRLFELLRRTSKTVTQVIQEGSFPVILAGNCSTTVGVQAGVVAARGAVPSCVWFDAHDD
FNTPDALASGYLDSMPVAMLAGLCWKTLLASIPNFKPLDLKKDLVHCGMRDVTELERSRV
IEAGFPVIWGNVDKHVEFEAELLKILQEKSLGETMVHLDLDSLDTSIGNVNKFSAPGGLL
EDDLEGCMSMIPKQTRPVSLTVASFDPSFDEDGKIPPVAIKGAVAFVKSLISEGVLESSQ
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcctccttctacttcaatcaccgtcatttactccccttaccatctcggcgcccgcgac
gtcgccgtcggtggtggaccaaccgctcttctcaaggccggcttcatcgatgccatttgc
aaacaaggcgtcacagttcgacagattgaacttgaacctgttgatgagtatgaaggcgat
attggccgtctctttgagcttctgcgccgcacttcaaagaccgtcacgcaggtcatccaa
gagggttcattccccgtcatcctcgccgggaactgttccaccactgttggcgtccaggct
ggtgtagttgctgcccgcggcgctgtgcccagctgtgtctggtttgatgctcatgatgac
ttcaacacgcctgatgcgctggctagtgggtatctcgactcaatgcccgtggccatgctg
gcgggtctttgctggaagacactcctggcgagcatccctaactttaaacctctagatctc
aagaaggaccttgtacactgcggcatgcgcgatgtgacggagctcgagcgttcgcgggtt
atcgaggccggtttccccgttatctggggcaacgtggacaaacacgtcgaatttgaagcg
gaactgctcaagattcttcaagaaaagtccctcggagagacaatggtccacttggacctc
gatagtctcgatacctctattggaaacgtcaacaagttctctgcacctggtggattgctg
gaggatgatcttgagggatgcatgagcatgattccgaagcagacaaggccggtgtcactg
acagttgcgtcatttgacccttcgtttgatgaggatggaaagattccgcctgtggctatc
aagggagctgttgcttttgtcaagagtctgatttcggagggtgttttggagagctctcag
tag

DBGET integrated database retrieval system