KEGG   Nectria haematococca: NECHADRAFT_76673Help
Entry
NECHADRAFT_76673  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
nhe  Nectria haematococca
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NECHADRAFT_76673
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     NECHADRAFT_76673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 782 aa AA seqDB search
MSAAPSPTINGLSAPLRSALKSEEDERPYPSSGSLKAVQIAEPESEIQMLEDESQPMKQF
SAGFRRRLSGKLVPSQLPNGSSRSSYSESPSPAHHAEDSGPTSHPTSHPHSHRRQYYSEK
LLAQVGDWLEHERTKAAGRKSNKKTTRRRKSKSPPKAKGAETASASGKEPERSRGSDQEQ
SGRSRSNSIDSDSSDVSFDRLQRILEDSMAHMGFTAVPHFPPKLTRPKNRKVPSRASLRG
ASSDTDYVDGDAIVPSCDAWLDNSKTMSYAGGGSTEDLTATNGSDDKVDKERENWLNFKN
EIIRIAHTLRLKGWRRIPLGGGDKISVERLSGALTNAVYVVHPPRNLEEVENKRMPSKLL
LRIYGPQVEHLIDRDNELQVLQRLARKRIGPRLLGTFQNGRFEQFFDSITLTPSDLRDPE
MSKQIAKRMRELHEGIELLPHERENGPATWRSWDQWLDNVERIATFLDQELEKEAKPPTE
RRNPIVHAWKSRGYVCGTPWPQFKDMIAKYRAHLYSHYKGGQREVKDKIVFAHSDTQYGN
ILRIRPDDEKSPLLQPANQHKQLIVIDFEYAGPNTRGLEFANHFNEWTYNYHDAVVPWAC
NERRYPTPDEQRRFVRAYVDHRPRFQGNGSTPRLAPSDGNLSSGTSTPIATPLSTPSNPP
ASSSSSIVEFMLDARVPPGGWSAAERANEEERDQRVRALLEETQWWRPANHAHWIAWGIV
QAKIPALDDVVKEEDLGPDEFDYLRYAQDRVMFFWGDCVQMGLVKKEELPELLQKRLKIV
EY
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggcaccgagccccacgatcaatggcctctctgcgcccttgcgctcggcactc
aagagcgaggaagatgaacgcccctacccgtctagtggctctctcaaagctgtgcagatt
gcggaacccgagtccgaaatccagatgctggaggatgagtcccagcctatgaagcagttc
tctgctggcttcagacgacgcctgagcggtaagctcgtgccatctcaactccccaacggt
tcttcaaggtcgtcatacagcgaaagtccttccccggctcaccacgccgaggactcgggg
ccaacgtctcatcccacttcccaccctcacagtcaccgccgccagtactacagtgaaaag
cttctagcccaggttggagactggctggagcatgagcggaccaaggcagccgggagaaag
tccaacaagaagaccacccgtcgacgcaagtccaagtcgcctcccaaagcaaagggcgcc
gagacggcctcagcttcgggcaaggagcctgagcgctctcgagggtctgatcaggagcaa
agtggccgctcgcgctctaattctattgactctgactcgagcgatgtttccttcgacaga
cttcagcgcatcttggaggactcgatggctcatatgggcttcacggcagttcctcatttc
cctcccaagttgacacgcccaaagaaccgcaaggttccctctcgggcctcactgcgaggt
gcctcctccgataccgattatgtcgatggagacgccatcgttcccagctgcgatgcttgg
ctggacaactccaagaccatgagctacgcaggcggtggtagcactgaggacttgacggcc
accaacggctccgacgataaggtcgacaaggagcgtgagaactggctcaacttcaagaac
gaaatcattcgtatcgcgcataccctcaggctcaaggggtggagacgcatccctcttgga
ggcggagataagatctcggtggagcgtctcagcggtgctctcaccaacgccgtctacgtt
gtccaccctcctcgtaaccttgaggaggttgagaacaagcgtatgccttccaagcttctg
cttcgtatctatggtccacaggttgagcacctcatcgaccgggacaacgagctccaggtg
ttgcagaggctggcacgcaagagaatcggaccacgactcctcggtacattccagaatggt
cggttcgaacagttcttcgattccatcaccctgaccccgtcggaccttcgcgaccccgaa
atgtccaagcaaattgccaagcgaatgagggagcttcacgagggcatcgagctactgcct
catgagagagagaacgggcccgcaacctggaggagctgggatcagtggctcgataatgtc
gagcggatcgccaccttcctggaccaggagctcgagaaagaggccaagccaccgacggag
cgacgcaaccccattgtccatgcctggaagagcaggggctacgtctgcggcactccctgg
cctcagttcaaggacatgattgccaagtaccgtgcccatctttacagccactacaagggc
ggccaacgggaagtgaaggacaagattgtctttgcccacagtgacacgcaatatggcaac
attcttcgaattcgccccgacgatgaaaagtcaccgcttcttcagcctgccaaccagcac
aagcagctcatcgtcatcgactttgagtatgcaggccccaacacgcgtggcctcgagttc
gccaaccacttcaacgaatggacgtataattaccatgatgccgtagtgccatgggcgtgc
aacgagaggcggtatcccacccccgatgagcagcgtcgtttcgtcagggcttacgtcgat
catcgcccccgattccaagggaacgggtccactccaaggctggctccttcggacgggaac
ttgtccagtggcacttccacgcctattgccacccccctgtcgactcctagcaaccctcct
gccagcagctccagctctatcgtggaattcatgcttgatgcacgagtgccccctggagga
tggagcgctgcagagcgagccaacgaggaggagcgagaccagcgcgtgcgagctctgttg
gaggagacgcagtggtggcgtccggccaatcatgcacactggatcgcgtggggtatcgtc
caggccaagatcccagcccttgacgacgttgtcaaggaggaggacctcggacctgacgag
tttgactacctcaggtatgctcaggatcgtgtcatgttcttctggggagactgcgtgcag
atgggtctcgtcaagaaggaggagctgccagagctcctgcagaagagactgaagattgtc
gagtactga

DBGET integrated database retrieval system