KEGG   Nectria haematococca: NECHADRAFT_78869Help
Entry
NECHADRAFT_78869  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
nhe  Nectria haematococca
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NECHADRAFT_78869
   00240 Pyrimidine metabolism
    NECHADRAFT_78869
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NECHADRAFT_78869
   03410 Base excision repair
    NECHADRAFT_78869
   03420 Nucleotide excision repair
    NECHADRAFT_78869
   03430 Mismatch repair
    NECHADRAFT_78869
   03440 Homologous recombination
    NECHADRAFT_78869
DNA repair and recombination proteins [BR:nhe03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      NECHADRAFT_78869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 198 aa AA seqDB search
MPATRRSAGGARSRGPPAKGQSTLTSFSSRVTKNVAKSAKKSIISPSITKIDPTQAPKQT
KVEEAVVEEPEPIEVDEEEEQPEVVPEPEKSEAELRAEQITDAQIKKYWKTIEEQWTSPR
LHQQGVSLSERVLRYFDVSSQYGPCIGTPRMKRWKRAERLGLNPPIEVLAVLLKEETKGN
KVQRAHMDEILNSTAVGS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcaactcgaagatcagccggcggtgcacgcagtcgcggccctcctgccaagggc
cagtccaccctcaccagcttctcgagcagagtgacaaagaatgtggcaaagagtgccaag
aagtccatcatctcgccttccatcacaaagatcgaccccactcaggccccaaaacagacc
aaggtcgaggaggctgttgtcgaagagcctgagcctatagaggtggacgaagaggaggaa
cagccagaggttgtgccagagccagaaaagtccgaggccgagctgcgcgcggagcagatt
acggatgcgcaaatcaagaagtattggaagacgatcgaagagcagtggacctctccccgg
ttgcatcaacagggtgtatcgctaagcgaaagggtcctccgatattttgatgttagctcg
caatacggaccctgtatcggcactcctcgtatgaagcgatggaagcgagctgagcgcctt
ggtctgaaccccccaattgaggtccttgccgtcctcctaaaggaagagaccaagggtaac
aaggttcaaagggcacatatggatgaaattctcaactccactgcggtggggagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system