KEGG   Nectria haematococca: NECHADRAFT_81639Help
Entry
NECHADRAFT_81639  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nhe  Nectria haematococca
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:nhe01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nhe00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:nhe00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:nhe00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 325 aa AA seqDB search
MKAFQYENSQKGLELRDIPKSEPGNGRVQLQVKAAGMCHSDCHIVSGSSDAWLTKKPITL
GHEVAGIITEIGPGVTGFNLGDRVAVSQVCHPVEERDWSLGIGLGFDGGYAQYAVAPARR
LMHIPGGVTFAQAAVATDALSTSYHAVVAEAAAKPGMIIGVVGLGGLGMSGLAFGALQGA
AMYGFDIDKDKFEEATRLGASGCFESLDLASDVAFDAIVDFAGTGNTTQNALKAVKEGGK
VVLVGLAAKKVEVPTELLVLRTVTLVGSLGASVDDLAQVLKLLKEGLIDPMLVEVPFSEI
PASIDALAKGGVKGRRWVDPSKVVE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcatttcagtatgaaaactcccagaaggggctagaacttcgagacattcccaag
tctgaacccggaaacgggcgagtccagctccaagtcaaggccgcaggcatgtgccactcc
gactgccacatcgtatccggctcgagcgacgcctggctcaccaagaagccaattactctc
gggcatgaagtcgcgggtatcatcaccgagatcgggcctggagttactggcttcaacttg
ggagacagagttgcagtgtctcaagtgtgccacccagtcgaagagcgcgactggtcgcta
ggcattggactaggcttcgacggtggctatgcccagtatgctgtggctcccgcacgccgc
ctcatgcacattccaggaggcgttaccttcgcccaggctgccgtggctactgatgcgttg
tccacttcgtatcacgctgtggtagcagaggctgcagcaaagcctggcatgattattggc
gtggtcggcctcggtggcttggggatgtcgggtcttgcgttcggagctcttcaaggagcc
gcgatgtatggcttcgacatcgataaggataaattcgaagaggcgacacgtcttggtgcc
agcggatgcttcgagagcttggatctggctagcgacgtggcttttgatgccatcgttgac
tttgccgggactggaaacacaactcaaaatgccctgaaggcagtcaaggaaggaggaaaa
gtagtgttggttggattggccgctaagaaggtagaggtgccaaccgagctgctggtgttg
cgtacggtgacactcgtcggttccctgggagcgagtgttgacgacttggctcaagtgttg
aagctcttgaaagagggactgatagatccgatgctggtggaggtgccgttctctgaaata
ccagccagtattgatgctttagctaaagggggggtcaagggaagacgctgggtagatcca
agcaaagtggtcgaatag

DBGET integrated database retrieval system