KEGG   Nectria haematococca: NECHADRAFT_81764Help
Entry
NECHADRAFT_81764  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
nhe  Nectria haematococca
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NECHADRAFT_81764
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    NECHADRAFT_81764
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     NECHADRAFT_81764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 302 aa AA seqDB search
MPYVSAARYGKDNVRVCKVDRDATTGIQTVTEMTVCCLLEGEIETSYTEADNSVVVATDS
IKNTIYITAKENPVNPPELYASILGSHFIQKYKHIHVANVNVKTVRWTRLAVDGKPHPHS
FFKDGEETRNVEVRVSRQDGIQIKSSIVGLTVLKSTGSAFHGFVRDEYTTLPETWDRIFS
TDVDASWKWNTFENAAAVQAFAPKFDKAWEVARAVTLKIFAEDDSASVQATMYKMAAQIL
ETVPEIDTVVYALPNKHYFEIDLSWHKGIKNTGKDAEVYAPQSGPNGLIKCEVSRDTLQP
RL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccttatgtatctgctgctcgttacggtaaggacaatgtccgcgtctgcaaggtcgac
cgtgatgctacgaccggcatccagaccgtcactgagatgaccgtctgctgtctccttgag
ggagagattgagacctcgtataccgaggccgataacagcgttgtcgtcgccaccgactcc
atcaagaacaccatctacatcaccgccaaggagaaccccgtgaaccctccagagctgtac
gcctctatcctcggcagccacttcatccagaagtacaagcacatccatgtcgccaacgtc
aacgtcaagactgtccgctggacgcgcctggccgttgatggaaagcctcatcctcacagc
ttcttcaaggatggcgaggagacgcgaaacgtcgaggtccgcgtgagccgccaggatggc
attcagatcaagagctccatcgtcggcctgaccgttctcaagagcaccggctctgctttc
cacggatttgtccgcgatgagtacaccaccctgccagagacttgggaccgcatcttctcg
accgatgtggacgcttcatggaagtggaacacctttgagaacgctgcggcagtccaggcc
tttgcccccaagttcgataaggcttgggaggtggcacgagccgttaccctcaagatcttt
gccgaggatgacagtgccagtgttcaggccaccatgtacaagatggctgctcagattctg
gagaccgtgcccgagattgacactgtcgtctacgcactaccaaacaagcactacttcgag
attgatctgagctggcacaagggcatcaagaacaccggcaaggacgccgaggtctatgct
ccccagtctggacccaacggtctcatcaagtgcgaggtgtcccgcgacactctgcagcca
aggctatag

DBGET integrated database retrieval system