KEGG   Nectria haematococca: NECHADRAFT_84813Help
Entry
NECHADRAFT_84813  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
nhe  Nectria haematococca
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NECHADRAFT_84813
Translation factors [BR:nhe03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    NECHADRAFT_84813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 338 aa AA seqDB search
MDNLWARRTNSGKLSLSTPGQGSSGDSFSRNASFPKRQGGDTPSSSKQNPFNTTPGGLVS
PTSGASSAFGLGSGAFASFGSAKTPKSSANPFDSAMGTAVAKSGQPKDLSKVVGKAPSMA
SISEGSQGAAAAAPVSHQLMEPWTFWYRPPISKAHGFIEYEKTLHEIATVRTVEEFWEIF
SYLKRPSSLPVVSDFHLFKKGVRPIWEDDVNKKGGKWVVRMKKGVADRYWEDLMLSLIGD
QFGDAGEDVCGAVLSVRNGEDILSIWTRTDGGRVIKIRETMKHVLNFPPNTRVEFKSHDS
SIQQRTAIEEQRREKAGQHHHHDKRHTGGVSKQPSEQS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggataacctctgggcccgccgcacaaactccggcaagctctccctctcgacacccggt
caagggtccagtggtgattccttcagtcgcaatgcttcctttccaaagcgccaaggcggc
gataccccgtcgtcgagcaaacagaaccccttcaacactacacctggcggcctggtctcc
cccaccagcggtgcctccagcgcctttggtctaggctctggagctttcgcctcctttggg
tctgcgaaaacacccaagtcctcggccaatcctttcgactcggctatgggcaccgcggtt
gcaaagtctggccagcccaaggacttgtcaaaggttgtggggaaggcccccagcatggcc
tccatctctgagggttcccagggggccgcggcggccgctcctgtatcacaccagctcatg
gagccctggactttctggtaccgacccccgatttccaaggcccacggcttcatcgaatac
gagaagaccctgcacgagattgctactgtgcggacggtggaggagttttgggagatcttt
tcctacctgaagcgcccctcctcgcttccggtcgtgtcggacttccatctcttcaagaag
ggcgtccggcccatctgggaggacgatgtgaacaaaaagggtggcaagtgggttgttcgg
atgaagaagggcgtggccgaccggtactgggaagacctcatgctctccctcattggggat
cagtttggtgacgctggagaggacgtttgtggtgccgtgctcagtgtaaggaatggagag
gacattctgagcatctggacccgaacggatggtggccgcgtcattaagattcgtgagacc
atgaagcacgtcctcaacttccctcccaacactcgagtggaattcaagagccatgactct
agtatccagcaacgaacggctatcgaggagcagcgccgcgaaaaggcgggacagcaccat
caccacgataagcgtcacacaggtggcgtgtcgaagcagccctcagagcaatcctag

DBGET integrated database retrieval system