KEGG   Nectria haematococca: NECHADRAFT_85080Help
Entry
NECHADRAFT_85080  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
nhe  Nectria haematococca
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    NECHADRAFT_85080
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    NECHADRAFT_85080
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     NECHADRAFT_85080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 1127 aa AA seqDB search
MSLSSDLDSKNTLTTTSLHKLSDMSSLTRSHLTQVQTTFPSHTQPVPIPMSAISASSVAS
NSQQGSPIMSPDTAVLTTNSSAQPSPEPMRGREEEAFPSSFQLPESVLFRKMSENSSGQS
LTSNPSAMSEAVGGNRSIMRRLSNRAHRFATSRRRQSSAAPASRDGSVGPSILRRRSDSN
ATAPPENSVLTDTDEEIEFVPDDSISFVGLDGAVYTSSANSTHGSISGSAGAMAGPVLPA
ELRNGSSVLKVSRKARPRKINLIYETETNKLSWDPARPQKSLHVDEIREIRTDSDIQQYI
LDFGMAQITEADKNLSANWFTIIYTVPESSKTKFLHIVTDNIASRILWTEFLDAMLRYRQ
ELMTSLMAFNDRAIAQYWQSEMAREFGDSPRGTDQEELDIAGVKRVCQSLHICSSQSTLE
VNFHLADSRRRQKLNFTEFKDFVRRMKQRTDVQRIIRSIAANPELGLTLAEFLDFLRDEQ
GEDIDSNRASWEKLFSRYSRRYRTDEVDTAENAQIMSEDAFVGFLTSEDNGPIAPEPQEY
TLDRPMNEYFISSSHNTYLLGRQVAGQSSVEGYISALVRGCRCVEVDCWDGYNGQPEVNH
GRTMTTSISFKEVMTTINKYAFIKSKFPLWISLEVHCNPSQQATMVEIIKDCFGSRLVTE
TLDAFPDKLPSPSELMERVLIKVKKPQIKEEVVSAGNDFRGRRRGNSLNSPMIRPTVPDS
AAIMPSQSLPQSPMLTPSHSTRRLVSKTRVNTITEGRVQDMMSSSTSDNESGAEQAAKKA
PNKTVKVLGDLGVYCAGVKFSGFDTMDAKQYNHIFSFMEASFAKHSRTKEQKMALDIHNM
RYMMRVYPDRTRITSNNFDPLIYWRRGVQMAALNWQTFDLGMQLNRAMFDGGKDYSGYVL
KPAELRDIQVLPYNSDIAEGKKERSVVTFSIDVISAQQLMRPANLPANKSINPYVEVEVF
HANDKRDKKESECILSLEPDSPPKVQTDIKPENGFNPMFDKHFKFRVTTKHPDLVFVRWS
VKLSTDGESFNERPAVATYTAKLTNLKQGYRTLPLLNHAGDQYLFSKLFCKIKVDPVEKK
LIDAPRRAQDGGNKLNRLGGKVFSRINTSPKSTIEKSSSEKTSFDSY
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcagctcagatctcgactcaaaaaacacattgactaccacttctcttcacaaa
ctatccgacatgtcctcattaacacgctctcacctcactcaggtccagacgaccttcccg
tctcatacacaaccagttcccatccccatgtcggccatcagcgcctcgtctgttgcctca
aattcacaacagggctcacccatcatgtctcccgacacagccgtcctgaccacaaattcc
tccgcccagccctcacctgagcccatgagagggcgggaggaggaggcctttccttccagc
tttcagcttcccgagtcggtgctgttccgcaagatgagtgagaactcatcagggcagagc
ttgaccagcaaccccagcgccatgtcggaagcagttggaggcaacaggagtatcatgcgt
cgcctctcaaaccgagctcatcgattcgctacgagcaggagacgacaatcttctgccgcc
ccggccagccgtgatggaagtgtgggacctagtatcttgaggagacgcagtgacagcaat
gccacggcgccccctgagaacagtgtcttgactgatacggacgaggagatagagtttgta
cctgatgactccatctcctttgttggcctggacggtgccgtctacacttcctcggccaac
agtacccacggttccattagcggaagtgctggtgctatggctggccctgtgctcccggct
gagctccgcaatggaagcagcgtcttgaaggtttcaaggaaagctcggccaaggaagatc
aatcttatttacgaaacagaaacgaacaagctgtcctgggaccctgctcgcccccaaaag
tcactacacgtggacgagatcagggagattcggacagactctgacattcagcaatacatc
ctcgactttggaatggcccagatcaccgaggctgacaagaacctctcggccaactggttt
accatcatctacaccgttcccgagagctccaagacaaagttcctgcacattgttaccgac
aacattgccagccggatcctttggacggaattcctcgacgccatgctcaggtatcgacag
gagctcatgacctctctgatggcctttaacgaccgggccattgcccagtactggcagagt
gagatggctagggagtttggcgattcgcctcgtggcaccgatcaggaggagcttgacatc
gcaggtgtcaagcgagtgtgccagagccttcacatctgcagctcccagtcaacactcgag
gtcaactttcatctggccgactctcgaagacgccagaagctcaactttaccgagttcaag
gactttgtgcggaggatgaagcaaaggacggatgttcagcgtatcatccgtagcattgct
gctaaccctgagctgggcctcaccctggccgagtttctagattttctccgcgatgagcag
ggcgaggatattgattctaaccgggcctcttgggagaagctcttctcccgctacagccgc
cgatatcgaactgacgaagtcgacactgccgagaatgcccagatcatgtcggaagacgcg
tttgtaggctttcttacttcggaggacaatggcccgatcgcccctgagccccaggagtac
accctcgaccgccccatgaacgaatactttatctcgagctcccacaacacctatctcctc
ggtcgacaagttgctggccagtctagcgttgagggctacatctcggccctggtccgaggc
tgccggtgtgtcgaggttgactgctgggatggctacaatggccagcccgaggtcaaccat
ggacgtaccatgacgacttcgatcagcttcaaggaggtcatgacaacgattaacaagtac
gccttcatcaagtccaagtttcctctttggatctccctggaagtccactgcaaccccagt
cagcaggccaccatggtcgaaattattaaggattgtttcggctcaaggctggtgacggag
acccttgacgcgttccccgacaagctcccctccccttcggagcttatggagcgtgtcctg
atcaaggtcaagaagccgcagattaaggaggaggttgtctccgctggcaacgacttcagg
ggtagacgccgaggcaacagcctgaactcgcccatgatccgaccgaccgttcccgatagc
gctgccatcatgccctcgcagtctctcccccagagcccgatgctcacgcccagccactcg
acccgcaggttggttagcaagacgcgcgtcaacacgattaccgagggccgggtccaggac
atgatgagcagcagcacgagcgacaacgagagtggagccgaacaggcagccaagaaggcg
cccaacaagacggtcaaggtgctcggtgacttgggtgtgtactgcgcaggcgtcaagttc
tccggattcgataccatggacgcgaagcagtacaaccacatcttttctttcatggaggcg
agctttgccaagcactctcgcaccaaggagcagaagatggcgctggatatccacaacatg
cgatacatgatgcgagtctaccccgaccgaacccgtatcacctcgaacaacttcgacccc
ctcatctactggcgtcgcggtgtccagatggcggctctcaactggcagacgtttgacctc
ggaatgcagctcaaccgcgccatgtttgacggtggcaaggactattctggctacgttctg
aagcccgcagagcttcgcgatatccaggttctcccgtacaattctgacatcgcagagggt
aagaaggagcgcagcgtcgtgacgttcagcatcgatgtcatctcggctcagcagctcatg
cgccctgccaacctccccgccaacaagtctatcaacccctacgtcgaagttgaggtgttc
cacgccaacgacaagcgagacaagaaggagtcggaatgcatcctgtctctggagcccgac
tcgccgcccaaggtccagacggatatcaagcccgagaatggctttaaccccatgtttgat
aagcatttcaagtttcgggtgaccacaaagcaccccgacctcgtctttgtgcgatggtca
gtcaagctctcgaccgacggtgagagcttcaacgagcgaccggcagtggcgacatacacg
gccaagctcaccaacctgaagcaagggtatcgaaccttgcctctccttaaccacgctggc
gaccagtacctgttctccaagctcttctgcaagatcaaggtggacccggtcgaaaagaag
ttgatcgacgcacctcggcgcgcccaggatggcggcaacaagctgaaccgtctgggcggc
aaggtgtttagccggatcaacaccagccccaaaagcacgattgagaagtcaagctcagag
aagacgagctttgacagttattga

DBGET integrated database retrieval system