KEGG   Nectria haematococca: NECHADRAFT_85123Help
Entry
NECHADRAFT_85123  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nhe  Nectria haematococca
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NECHADRAFT_85123
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     NECHADRAFT_85123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 312 aa AA seqDB search
MAPSEDGVLVAASNKKRPASVSGSSTGSSDDSSRRKKRRDRKNGSSKKRSNGDISVPGAF
AQRRNSLAKASRDPRDEPLPKKKRAVAEGAVVKTRSPSPVIDFDGLSRPSRGTRERREET
KEQAEQRLDRMRGAVRTLLECVGEDPDREGLLDTPSRYAKALLFLTQGYQVNAEDIVNNA
LFREGHSEMVVVKDIEVFSLCEHHLVPFTGKMHIGYIPNETVIGLSKLPRIAEMFARRLQ
IQERLTKEVANAIMEILKPQGVAVVMESSHLCMVMRGVEKTTTSTITSCVLGCFERKSKT
RNEFLNLIGINR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggctccttcagaagacggcgttctcgtcgcagcaagcaacaagaagcgccccgccagc
gtctcggggtcttcgaccggtagcagcgatgattcgagccgtcgcaagaagcgtcgcgat
cgcaagaacggaagcagcaagaagcgaagtaatggtgacatatctgttccaggtgctttc
gcgcagcgccgcaacagccttgccaaggcctcgcgggatcctcgcgatgaacccctcccc
aagaagaagcgcgccgttgcagagggcgctgtcgtcaagacgaggtcgcctagtcccgtg
attgactttgatggtcttagtaggccaagccgcggcacccgagagagacgagaagagaca
aaggaacaagccgagcagcgcctcgatcgcatgcgcggtgccgtgcgcacgctcctcgag
tgcgtcggcgaagatcccgaccgtgagggtctcctcgacacgccctcgcgctacgccaag
gctcttctcttcttgactcaaggataccaggtcaatgctgaggatatcgtcaacaatgct
ttatttagggaggggcatagtgagatggttgttgtcaaggatattgaagtcttttctctt
tgcgagcatcacctcgtcccctttacaggcaagatgcacatcggctacatccccaacgaa
accgtcatcggcctctccaagctcccccgcatagccgaaatgtttgcccgccgccttcag
atccaggagcgcctcacaaaggaagtcgccaacgccatcatggagatcctgaaaccccag
ggtgtagccgtcgtcatggagtcgagccacctgtgcatggtgatgcgcggcgtcgaaaag
accaccacttccaccatcaccagctgcgtcctcggatgcttcgagcgcaagtccaagacg
cgcaacgagtttctcaacctcatcggtatcaaccgataa

DBGET integrated database retrieval system