KEGG   Nectria haematococca: NECHADRAFT_85746Help
Entry
NECHADRAFT_85746  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
nhe  Nectria haematococca
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:nhe00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:nhe00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 1069 aa AA seqDB search
MAESVPIPEPPGYPLIGNLGEFTTSPLADLKRLADTYGPIFRLRLPGKSPIFAANNAFVN
ELCDEKRFQKTLKSVLGTVREGVHDGLFTAYNDEPNWGKAHRILLPAFGPLSIRSMFDEM
HDIATQMCMKFARHGPQTPINASDDFTRLALDTLALCSMGFRFNSYYREELHPFIQAMGD
FLTESGVRNRRPTFAPNFLYRAANEKFLADIKVMKDLAAEVVANRKERPNDRKDLLTAML
EGVDPQTGEKLSDDNIGNQLVTFLIAGHETTSGTLAFSFYNLLKHPEAYEKAQQEVDQVI
GRGPITVEHLTKLPYLSAILRETLRLNSPIPGFGVEAIEDTFLGGKYLVKKGEIVSCMLS
KAHLDPVVYGEDAEAFRPERMLDENFERLQKEHSNCWKPFGNGKRACIGRPFAWQEALLA
LAMLLQNFNFTMDDSNYQLQIQETLTIKPKHFNMRATLRYGMTPTELERVLAGRGADSHA
TSGTKSSAAAGTKGAGGKPISIYYGSNSGTCEALAQRLASDAPGHGFAAKNIGPLDEAKQ
NLPEDHPVVIVTASYEGQPPSNAAHFINWMERLNGQEMEKVSYAVFACGHHDWVETFHRI
PKLVDATLEKRGGTRLVPMGSADAAVSDMFSDFEAWEDETLWPALKEKYGGDGGDSQAGS
QRGLLVELSTPRKTRLRQDVEEALVVSEKTLTASGPPKKNIEIQLPTGMTYKAGDYLAIL
PLNPKTTVGRVFRRFKLAWDVFLKIHSEGPTTLPTDTEISAYDVFSAYVELSQPATKRNI
LALVEATEDKAVIEELEKLTGDAYAEEISAKKVSVLDLLEKYPAVALPISSYLGMLPPMR
VRQYSISSSPLANSSKLTLTYSLLDEPSLSGQGRHVGVATHFLSSLSAGEKLHVSVRPSV
AAFHLPSDAENTPLICIAAGTGLAPFRGFVQERAAMLAAGRNLAPAMLFFGCRNPDIDDI
YADEFDRWEKMGAVSVRRAYSRATDKSEGCKYVQDRLYHDRADVFKLWDQGAKVYICGSR
EVGKAVEAVCVRLVVEWSEEHMECTSTEEKAREWFEKHRNERFATDVFD
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtctgttcctattccggaaccccctgggtatcccctcattggaaacttgggc
gagttcaccaccagcccgttggctgacttgaaacgcctggccgatacctatggccccatc
ttcagactacgcctacctggcaagtctcccatctttgcagcaaacaatgcctttgtgaac
gagctctgtgacgaaaagagattccagaagacgctcaagtctgtcctgggtactgttcga
gaaggtgttcatgatggcctctttacggcttacaatgatgagccaaactggggcaaggcg
catcgaattctgctccccgcctttggacctctctccatccgcagcatgtttgacgagatg
catgatatagctacccagatgtgcatgaagtttgctcgccacggtcctcaaactcccatc
aacgcctcggatgattttacccgtctcgcccttgacactcttgccctttgctccatgggc
tttcgcttcaattcatattaccgcgaggagctgcacccattcattcaggctatgggagac
ttccttaccgagtccggtgtgagaaacagacgcccgacctttgcccccaactttctctac
cgtgcagcaaatgaaaagttccttgccgacatcaaggtcatgaaggacctggccgctgaa
gttgtggccaaccggaaggagaggcctaacgatcgaaaggacctgctcactgccatgctt
gagggggttgaccctcagactggcgagaagctctcagatgacaacattggcaatcagctc
gtcacattcctgattgctggccacgagacaacctcaggcacactggcattctctttttat
aacttactcaagcacccagaggcctatgagaaagcacagcaagaagtcgaccaagtcatt
ggccgtggtcccatcactgttgagcacctcaccaagctcccgtacctttctgctatccta
agagaaactttacgactcaattccccaatccccggctttggtgtagaggccattgaagat
accttcctgggaggcaagtaccttgttaagaagggggaaatcgtgtcttgcatgctatct
aaagcccatctcgaccctgttgtctacggtgaagatgccgaggcattccgccctgagaga
atgctggacgagaatttcgagaggctccaaaaggagcattccaattgctggaagcctttc
ggaaatggcaaacgcgcctgtattggaagacccttcgcctggcaggaggcccttcttgcc
ttggcaatgctcttgcaaaacttcaactttaccatggatgattccaactaccagctccag
atacaggagacgttgacaatcaagccaaagcacttcaacatgcgagcaactcttcggtac
ggcatgactccgactgaactcgagcgtgtcttggctggccgaggcgccgatagccatgca
acttcgggtaccaagtcttctgcagctgctggtacaaagggggccggcggaaagcccatc
tcaatctactatggctccaacagtggcacttgcgaagcccttgctcaacgattggcctcg
gatgcgccaggccacggcttcgctgctaagaacattggccctctagacgaggccaaacag
aacctccctgaagatcatccagttgtcattgttactgcgtcatatgagggccagccccct
tccaacgctgcccatttcatcaactggatggaacggctgaatggacaggagatggaaaag
gtttcctacgccgttttcgcatgcggccaccatgactgggttgaaacgttccaccgaatc
cccaagctcgtggatgcaactctggagaagaggggtggaactcgccttgtccctatgggc
agtgctgatgccgcagttagcgacatgttcagtgactttgaggcatgggaagacgaaacc
ctctggcctgccttgaaggagaagtatggcggtgatggtggtgatagtcaagctggctca
cagcgaggcttgctagtggaactgtcaactccgagaaaaacgagacttcgacaagacgtc
gaagaagccttggtggtttcggagaaaacacttaccgcgtcggggcctcccaagaagaac
attgagatccagctccccacgggtatgacatacaaggccggtgattatctagctatctta
cccctgaaccccaaaaccactgtcggacgcgtctttcgccgattcaagctcgcttgggat
gtcttcctcaaaattcactcagagggaccaaccactctcccaacggatacagaaatctct
gcgtacgacgtcttcagtgcctatgtggagttatcacagccggcaaccaagaggaacatc
cttgccttggtagaagccaccgaagacaaggccgttattgaggagctcgaaaagcttacc
ggggatgcatacgctgaggaaatttcggccaagaaggtgtcggtccttgatctcctcgag
aagtacccggccgtcgccctccctatcagctcatatcttggcatgttgcctcccatgagg
gtccgtcaatactctatctcgtcttctccgcttgcaaactcttccaagctcacacttacg
tattctctgctcgacgaaccatcgctttctggccagggtcgccatgtcggtgttgcgaca
cacttcttgtcgtcactttctgctggagagaagcttcacgtctcggttcgtccttcagtt
gcagctttccatctcccaagtgatgccgaaaacacgccgctcatctgcattgcggctggt
actggcctcgcaccgttccgtggttttgtgcaggagcgggctgctatgcttgctgctgga
cgaaacctcgcaccggccatgctcttctttggttgccgtaaccccgatatcgacgatatc
tatgctgatgaattcgatcgctgggagaagatgggggcggtttcggtacgacgggcctat
tcccgagcgacggacaagtcagagggatgcaagtacgtgcaggacaggctgtatcacgac
cgcgccgatgtgttcaagttgtgggatcagggcgccaaggtttatatctgcggaagccga
gaggttggcaaggcagtggaagctgtctgcgtccgtctcgtggtggagtggtcagaggag
cacatggagtgtacttcaacagaagaaaaggcacgggaatggtttgagaagcatcgcaat
gagcgattcgccacggatgtatttgattga

DBGET integrated database retrieval system