KEGG   Nectria haematococca: NECHADRAFT_86582Help
Entry
NECHADRAFT_86582  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     NECHADRAFT_86582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 356 aa AA seqDB search
MPSLFKTALLTLAIASEVLGRPKAAQGLDSAIKAKGKQHVGTALTLGSDSRTEDIIKGPS
EFGAITPENAMKWQSTQPRRGEFTFSSADQHANFAVNNNKELRCHTLVWHSQLAPWVEAG
NFDNQTLVKIMEDHINTVAGRYKGKCTHWDVVNEALNEDGSYRQTVWYKTIGEAYIPMAF
RLAAKADPNAKLWYNDYNLEYNNAKTAGAARIVKLVQSYGVKIDGVGLQGHLVVEPTPTQ
PTITPSRETLEGALRKFTDLGVFVEYTEVDIRMKTPATKEKLEEQSKAYQRVVESCMAIQ
KCIGITLWGVSDKYSWIPSTFQGEGAALVWDEEFQKKPAYQGILNAIKAAKSKWWY
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccttcacttttcaagacagccctcctgaccctggccatcgccagcgaggttctcggc
aggccaaaggcagcccaaggcctcgatagcgccatcaaggcgaaagggaagcaacatgtc
ggcacagccctcactctcggcagcgactcccgcacggaggacatcatcaagggcccatcc
gagtttggtgccatcaccccagagaatgccatgaagtggcagtctacccagccaaggcgt
ggcgagttcacttttagctctgctgatcagcacgccaatttcgccgtcaacaataacaag
gagcttcgctgccatacccttgtctggcatagtcagctggctccttgggttgaggcgggt
aactttgacaaccagactttggtcaagatcatggaagatcacatcaacactgttgctggc
aggtacaaggggaagtgcactcactgggacgttgtcaacgaggctctcaatgaggacggt
agctaccgccagaccgtctggtacaagaccatcggagaagcttacattcccatggccttc
cgcctcgctgccaaggcggatccgaatgccaagttgtggtacaatgactacaaccttgag
tataacaacgccaagacagccggagcagcgcgcatcgtcaagctcgtccaatcctacggt
gtcaagattgacggcgttggcctgcagggacatctcgttgtagagcccacgccaactcaa
ccaaccatcactccctcccgtgagacactcgaaggggccttgaggaaattcaccgatctt
ggagtctttgttgagtacaccgaggttgacatccgcatgaagacacctgcgaccaaggag
aagctcgaggagcagtccaaggcttatcagcgggtcgtggagtcgtgcatggccatccag
aagtgcatcggcatcacactttggggagtttcggacaagtattcgtggattcctagcacc
ttccagggtgagggcgctgctttggtgtgggatgaggagttccagaagaagccggcctac
cagggtattttgaatgccattaaggcagcaaagtctaagtggtggtattga

DBGET integrated database retrieval system