KEGG   Nectria haematococca: NECHADRAFT_87127Help
Entry
NECHADRAFT_87127  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
nhe  Nectria haematococca
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    NECHADRAFT_87127
  Lipid metabolism
   00561 Glycerolipid metabolism
    NECHADRAFT_87127
   00600 Sphingolipid metabolism
    NECHADRAFT_87127
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    NECHADRAFT_87127
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     NECHADRAFT_87127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 731 aa AA seqDB search
MTRSIIHPVPENQKTDPIVVNGLSFALNGTNVSYRFHVDSTSGDLVQDHFGDRVTEDPVA
EPAAVIGGWSLQDHLRREFPDLGRGDFRAPAIQIKQAKGYTVSDFKYKSHSVVKGKPALD
GLPCTFGHDDEVSTLVIHLWDSCSSVAADLSYSIFPKHDAIVRSVKITNQSDEEVTIEKL
ASISVDLPHREYEMLQLRGEWTRECTRTRRKVDYGLQGFGSRTGYSSHFNNPFLSLVSSE
TTESHGEAWGFSLIYTGSFEVEVEKSPQGITRALVGMNPSQLSWPLKPGDSLQSPECVSV
FSNAGIGAMSRKFHRLYRQHLIKSKFVNEPRPALLNSWEGLYFNFNEDTIYRLAQASADL
GVKLFVLDDGWFGDKYPRVDDKAGLGDWTVNPERFPDGLKPLADKVSQLQAAGSKENLKF
GLWFEPEMISQKSALYEQHPDWALHAGNYPRTETRSQLVLNVALSEVQEYIINSVANILD
NVPISYVKWDNNRAMHETPTPANYHAYILGMYRVFDRLTSRFPEVLWEGCAAGGGRFDAG
ILQYFPQVWTSDNTDGLDRIQIQFGTSLVYPASTMGAHVSAVPNEVTGRTTPIRFRAHVA
MMGGSFGLELDPDAIPAEEKAQIPELIALAEKINPIIIRGDMWRLNLPETSNHPAALFIS
EDGSQAVLFAFQIRAATVHNYSFIRLQGLDPSAKYKLDGEGTFSGATLMNGGVQYRFKSD
YESKVVLIERV
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgacacgatccattatccatccagttcccgagaatcagaagactgatcctatcgtggtg
aatggactttcgttcgcgctcaacggaaccaacgtctcgtaccggttccacgttgatagc
acttcgggagatctcgtccaggaccacttcggtgaccgggtgacagaagatcccgtggcc
gaacctgccgccgttatcgggggatggtcactccaagatcatcttagacgcgagtttccc
gatctcggccgaggagacttccgagccccggctatccagatcaaacaggccaagggctac
acagtatctgacttcaagtacaagtctcacagtgttgtaaagggtaaacctgctctagat
ggcctgccctgcacgtttggtcacgatgacgaggtgtcaacactggtgatccacctctgg
gacagctgcagttcagtcgctgcggatttgtcctactcgatatttcccaagcatgacgcc
attgtgcgaagtgtcaagatcacaaaccaaagcgatgaggaggtcaccattgagaagctg
gcaagcattagtgttgacctacctcatcgtgaatatgaaatgcttcagctcaggggtgag
tggacacgagagtgcacgagaactcgccgaaaggtggattatggtctacaaggctttgga
agcaggacaggatactcatcgcacttcaacaacccgttcctttccctcgtttcgtcagaa
accacagagtcacacggcgaggcttggggattctctctcatctacaccggctcttttgaa
gtcgaggttgagaagagccctcaaggcataacgcgcgcccttgtcggcatgaatccctcc
cagctttcatggcccctcaagccaggggactcgctgcaatccccagagtgtgtctctgtc
ttctcaaatgcgggaatcggtgccatgtcacgcaagttccatcgcctctatcgtcagcac
ctcatcaagagcaagttcgtcaacgagcctcgaccggcgcttctcaacagttgggaggga
ctctactttaacttcaacgaggacaccatctatcgacttgcacaagcatctgcagatttg
ggcgtgaagctgttcgtgctggatgatggttggttcggagacaagtatcctcgagttgat
gacaaggcaggcctgggagactggaccgtgaaccccgagagatttcctgatggtctcaag
ccgcttgccgacaaggtcagccagctccaagctgcgggctccaaagagaatctcaagttt
ggcctctggtttgaacctgagatgatcagtcaaaagtcggctctttacgaacaacaccct
gactgggcgctgcatgccggcaactaccctcgaaccgagacccgcagccagctcgtgttg
aacgtggctctttctgaagtacaggaatacatcatcaactctgtcgccaacattcttgac
aatgtccccattagctacgtcaagtgggataacaaccgggccatgcacgagactccgaca
cctgccaattaccatgcctatattctcggcatgtatcgtgtctttgacaggttgacttct
agattccccgaggtcctctgggaaggctgcgcagctggtggcggcagattcgacgctggt
atcttgcaatacttcccccaggtctggacgtctgataacacggatggtcttgaccggatt
caaatacagtttggcacatccttggtctacccagcatcgacaatgggggcacatgtttcc
gctgtacccaacgaagttacaggacgcacaactccgatccgattcagagctcacgtcgcc
atgatgggaggatcattcggtctagagctcgatcctgatgccatacctgcagaagagaag
gctcagattccagaacttattgcccttgccgaaaagatcaaccccatcatcatccgagga
gacatgtggagattgaacctcccagagacctccaaccatcctgctgcactcttcatctcc
gaggatggaagtcaagctgtgctgtttgcgttccagattcgggccgcgacagtgcataac
tactccttcattcgcttgcaggggctcgatccttctgcaaagtataagcttgatggagag
ggaacgttctctggagcgactctgatgaatggtggcgttcaatatcggttcaagtctgac
tatgagagcaaggtggttttgatagagagggtatag

DBGET integrated database retrieval system