KEGG   Nectria haematococca: NECHADRAFT_89636Help
Entry
NECHADRAFT_89636  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     NECHADRAFT_89636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 284 aa AA seqDB search
MAIVEGWLPPTREHYDLILKIWQISYPIVGSIQWLTKWYGMGKTSVASRLNLPGRIGWLT
MEAPGFLTLLYLMKTLPEQHSIDDLPWQNKVLAGLFVIHYSYRAVMFPYLQPSMSPLHIA
VWLLGVSFQIFNATCLGSWLAAYGPTTEEAWASQSSILQFSAGILIFYLGLSGNFFHDEE
LREIRRREAQRAQRDEAKANVEKHYQIPQAGLFRYMLYPHYLCEWVEWAGFWMAAGWGCA
PARAFLINEIFAMLPRAVRGKRWYLERFGEDKVGKKWAVIPGVW
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgttgaagggtggctgccacccacccgggagcattacgacctcatcctcaaa
atctggcaaatctcttatccgattgtcggttcaatccaatggcttaccaaatggtatggc
atgggcaagacatcggtggccagccgcctgaacctcccaggccgcataggctggttgacc
atggaggccccaggcttcctgacgttgttgtacctcatgaagacccttcctgagcagcac
agcattgatgatctaccttggcagaataaggtgcttgcgggcttgtttgtaatccactac
tcttaccgcgccgtcatgttcccctatctccaaccatccatgtcaccacttcacatcgcg
gtgtggctgcttggggtcagctttcagatcttcaacgcaacttgtctgggctcctggctt
gctgcctacggcccaaccactgaggaagcatgggcctcgcagtcgtccatcctccagttc
tcagctggcatcctcatcttctatcttggactgtcgggcaacttctttcacgatgaggaa
ctccgagagatccgccgaagggaggcccaacgggctcagcgcgacgaggccaaggcgaac
gtggagaagcactatcagatcccgcaggcgggtttgtttaggtatatgctgtacccgcat
tacctgtgcgaatgggtggagtgggctgggttctggatggcagccggatgggggtgcgct
ccagcgagggcgttcctcatcaatgagatatttgccatgttgccgcgagcggtgaggggg
aagcgttggtacttggagaggtttggggaggacaaggtgggaaagaagtgggcagtgatt
ccaggggtgtggtga

DBGET integrated database retrieval system