KEGG   Nectria haematococca: NECHADRAFT_89859Help
Entry
NECHADRAFT_89859  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nhe  Nectria haematococca
Pathway
nhe00010  Glycolysis / Gluconeogenesis
nhe00071  Fatty acid degradation
nhe00350  Tyrosine metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NECHADRAFT_89859
  Lipid metabolism
   00071 Fatty acid degradation
    NECHADRAFT_89859
  Amino acid metabolism
   00350 Tyrosine metabolism
    NECHADRAFT_89859
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NECHADRAFT_89859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 9677282
NCBI-ProteinID: XP_003049707
JGI: 89859
UniProt: C7YWP5
Position
1
AA seq 360 aa AA seqDB search
MDQVDPLPLTCKAGVVVRHGPDFKVEIQYVPVPEPGSDEILIRLNATGICYSDIHYMLED
LPLPRMRDYGVRSPGHEGAGVVVKVGVLVRNWKPGDRAGVKPTWNTCMSCQLCWSGLECH
CAEAVPTGLKVSGTYQQYILSPARYASKIPDGVDDFSAGPIMCSGSTMHRSLVESQLRPG
DWAAFLGAGGGVGHMGVQLAKAMGLRVIGIDAGEKKRKMCMDLGCEEFVDFADTEDIPEE
IKRITSGKGVDGVFVTASSPKSYAMATKMACIGGKIMCVGMPPSGTAFAGDDPMFLMLRN
LKVIGTLTGSMKDTEDALEFAARGLLKPVYELFGIDRLPEAVDLLRQGKVAGRCVIDFNT
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaccaagttgatcctcttccactcacttgtaaagcaggggttgtggtacgacatgga
cctgacttcaaagtagaaattcaatacgtgcctgtccccgagcccggctcggacgagatt
ctgatccgactcaacgccactggtatatgttatagcgatatacactacatgctggaggat
ttgccactgccaagaatgagagactacggggttcgatccccagggcacgagggcgcaggc
gtagttgtcaaggttggtgttctcgtcaggaactggaaacccggtgaccgcgccggagtg
aaaccaacttggaacacgtgcatgtcttgccagctctgctggtcagggctcgaatgccac
tgtgctgaggctgtgcctactggcctcaaggtttcaggaacttaccagcagtatatcttg
agcccagctagatacgcttctaaaatcccggacggggtagacgacttctcggctggtccc
atcatgtgcagcggatcaactatgcatcgatctcttgtagagtctcaacttcgacctgga
gattgggccgcatttcttggagctggtggaggcgtaggccacatgggcgtacagcttgcc
aaggcaatgggccttcgagtgatcggtatcgacgctggcgagaagaaacgcaaaatgtgc
atggatcttggctgcgaagagtttgttgactttgccgatacagaggacatccctgaagag
atcaaacgcatcacctctgggaaaggagttgacggggtgtttgtcacggcatcatcacca
aagtcgtatgcaatggctaccaagatggcctgcatcggtgggaagatcatgtgtgttggg
atgcccccttctgggactgcctttgctggcgatgatcccatgtttctgatgctccgcaac
ctcaaagtcattggaacactcactggatccatgaaggacactgaagatgcgctggagttt
gctgcacggggtttattgaaacccgtatatgagctgtttggcattgatcgcttaccggag
gctgttgacttattgagacaaggaaaggttgcgggccggtgcgtgattgacttcaacacc
taa

DBGET integrated database retrieval system