KEGG   Nectria haematococca: NECHADRAFT_89932Help
Entry
NECHADRAFT_89932  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NECHADRAFT_89932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 345 aa AA seqDB search
MASATRHFSVAPRQVFRQNGRRYYSSEPAQKSSSAWIWLTGAAVAGGAGWYFYANGASAT
PKVFNPTKDDYQKVYNEIANRLEEKDDYDDGSYAPVLLRLAWHASGTYDKETGTGGSNGA
TMRFAPESDHGANAGLLAARNFLEPVKAKFPWITYSDLWILGGVCAIQEMQGPVIPYRPG
RSDRDVSACTPDGRLPDATKSSNHLRDIFYRMGFNDQEIVALSGAHALGRCHTDRSGFDG
PWTFSPTVLTNDYFRLLIEEKWQWKKWNGPAQYEDKSTKTLMMLPTDMALVQDKKLKPFV
EKYAKDNDAFFKDFSDVVLRLFELGVPFAQGTENQRWTFKPTYDS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgctactcgacacttctccgttgctcctcgtcaggtcttccgtcagaacggc
cgccgctactactcctctgagcctgcccagaagtcctcttcggcctggatctggctcact
ggtgccgctgttgctggtggtgctggttggtacttctacgccaacggtgcttccgccacc
cccaaggtcttcaaccctaccaaggacgactaccagaaggtgtacaacgagatcgccaac
cgcctggaggagaaggatgactatgatgatggcagctacgctcccgtcctcctccgactt
gcctggcacgccagcggcacctacgacaaggagactggcaccggtggcagcaacggtgct
accatgcgtttcgcccccgagtccgaccacggcgccaatgctggtctgctcgctgcccgc
aacttccttgagcctgtcaaggccaagttcccctggatcacctactctgatctttggatc
cttggtggcgtttgcgccatccaggaaatgcagggtcctgtcatcccctaccgacctggc
cgcagcgaccgtgatgtctctgcttgcactcctgatggccgtcttcccgacgccaccaag
agctccaaccacctgcgagacatcttctaccgcatgggattcaacgatcaggagatcgtg
gctctctctggtgcccacgctctcggccgatgccacactgaccgatccggcttcgatggc
ccctggaccttctctcctactgtcctgaccaacgactacttccgtcttctcatcgaggag
aagtggcagtggaagaagtggaacggccctgctcagtatgaggacaagtccaccaagacc
ctgatgatgcttcccaccgatatggctcttgtccaggacaagaagctcaagcccttcgtc
gagaagtacgccaaggacaacgatgccttcttcaaggacttttcggatgtcgttctccga
ctcttcgagcttggtgtccccttcgcccagggcaccgagaaccagcgatggaccttcaag
cccacttacgattcgtaa

DBGET integrated database retrieval system