KEGG   Nectria haematococca: NECHADRAFT_90219Help
Entry
NECHADRAFT_90219  CDS       T01612                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nhe  Nectria haematococca
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nhe01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nhe00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nhe00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nhe00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:nhe00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 676 aa AA seqDB search
MATVENPQVPVEPAVAPEKTQETKAPVVAEAHLVDTYQHPHRPHLANLEEYKRLYKESIT
QPNKFWAERARELISWDRDFQTTRSGSLQNADVSWFNEGRLNASYNCVDRHAFADPDRVA
IIYEADDPSEGRNVTYSELLREVSRTAWVLKQMGVRKGDTVAIYLPMIPEAIVALMACVR
IGAVHSVIFAGFSADSLRDRVVDAGSKVVITTDEGKRGGKLIGTKKIVDDALKQCPDVEH
VLVYKRTGSEIPWTTGRDFWWHEEVEKWPNYFPPEPMASEDPLFLLYTSGSTGKPKGVLH
TTAGYLLGAAMTGKYVFDIHEGDRYFCGGDVGWITGHTYVVYAPLMLGVSTVVFEGTPAF
PNFSRYWDIIERHNVTQFYVAPTALRLLKRAGDEHVRGKFAHLRVLGSVGEPIAAEIWKW
YFEIIGKEECHIVDTYWQTESGSHTLTPLAGITPTKPGSCSLPFFGIEPALIDPVSGEEI
HGNDVEGVLAFKQPWPSMARTVWGAHKRYKETYLDVYKGYYFTGDGAARDHEGFYWIRGR
VDDVVNVSGHRLSTAEIEAALLEHHAVADAAVVGIADELTGQAVNAFVDLKENVESTDAL
RKELVIQVRKSIGPFAAPKAVYIVPDMPKTRSGKIMRRVLRKIVAGEEDQLGDITTLSDP
SVVEKIIKSVHEAKRK
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgtcgagaacccccaagtccccgttgagccggctgtggctcccgagaagact
caagagaccaaggcccccgtggttgctgaggcccaccttgtcgacacctaccagcacccc
cacaggccccaccttgccaacctcgaggagtacaagcgactctacaaggagtccatcacc
cagcccaacaagttctgggctgagcgcgcccgtgagctcatctcgtgggaccgcgacttc
cagaccacccgcagcggtagcctccagaacgccgacgtctcgtggttcaacgagggtcgc
ctcaacgcctcttacaactgtgtcgaccgccacgcctttgctgatcctgaccgtgttgcc
atcatctacgaggccgacgaccctagcgaaggccgcaatgtcacctacagcgagctcctc
cgcgaggtttcccgcaccgcctgggtcctcaagcaaatgggtgtccgcaagggcgacact
gttgccatctacctgcccatgattcccgaggccattgtcgcccttatggcctgtgtccgt
atcggtgctgtccactccgtcatctttgccggtttctctgccgactctctccgcgaccgt
gttgtcgatgctggctccaaggttgtcatcaccaccgacgagggcaagcgaggtggcaag
ttgattggcaccaagaagattgtcgacgatgctcttaagcagtgccccgacgtcgagcac
gtcctcgtctacaagcgcactggctctgagatcccctggaccaccggccgtgacttctgg
tggcacgaggaggttgagaagtggcccaactacttccctcctgagcccatggcttctgag
gaccctctcttcctcctgtacacctctggttctaccggcaagcccaagggtgttttgcac
accactgccggttaccttctcggcgctgccatgaccggcaagtacgtcttcgatatccac
gagggcgaccgatacttctgcggtggtgatgtcggttggattactggccacacctatgtc
gtctacgcccctctgatgctcggtgtctctaccgtcgtctttgagggtactcccgccttc
cccaacttctcccgatactgggatatcatcgagcgccacaacgtcacccagttctacgtc
gcccctactgccctgcgactgctcaagcgtgccggtgacgagcatgttcgaggcaagttc
gctcacctccgggtcctgggctctgtcggtgagcctattgctgctgagatctggaagtgg
tactttgagattatcggaaaggaggagtgccacattgtcgacacctactggcagactgag
tccggttctcacacccttacccctcttgctggtatcactcccaccaagcccggcagttgc
tctctgcccttcttcggcatcgagcccgccctcatcgaccccgtgtcgggtgaggagatc
cacggcaacgatgttgagggtgtcctggccttcaagcagccctggcccagcatggcccgc
accgtctggggagcccacaagcgatacaaggagacctacctcgatgtctacaagggctac
tacttcaccggtgatggtgctgcccgtgaccacgagggcttctactggatccgaggacgt
gtcgatgatgtcgttaacgtcagcggtcaccgtctgtcgactgccgagatcgaggctgcc
ctcctcgagcaccacgccgttgccgatgccgccgtcgttggtattgccgacgagctcacc
ggccaggctgtcaacgcctttgttgatctcaaggagaacgttgagtcgactgacgctctt
cgcaaggagctcgtcatccaggtgcgaaagagcatcggaccgtttgccgcccccaaggcg
gtgtacattgtccccgacatgcccaagacacgaagtggcaagattatgcgccgtgtgttg
agaaagattgtcgcgggtgaggaggatcagcttggtgatatcactactctatctgatccc
tctgtcgtggaaaagattatcaagagcgtgcatgaggccaagcgcaagtag

DBGET integrated database retrieval system