KEGG   Nectria haematococca: NECHADRAFT_91463Help
Entry
NECHADRAFT_91463  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.20  tannase
     NECHADRAFT_91463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 583 aa AA seqDB search
MNYDDEYRFLIQGHLFSLKSPVHGASLSDICSKTYAKSALPADGFISGITIDPDSVQTTL
VSNASFQSEWYPTATADYCNLTFAYSHDGIDSDVVHVSYLLPAPSKLQNRYVSTGGGGLA
INSGSQYAASGLIVGAVSGITDGGFGSFNTQWDEVFLLANGTINWQSVYMFGYQAHHELA
LLGKELARNLYNVSKSSKVYSYYQGCSEGGREGWSQVQRFADQFDGAAIGAPAFRYGQQQ
VNHLFGNVVEQTLDYFPPSCELDKILNLTITACDGLDGREDGVVSRSDLCKLNFNLNSTI
GTAYSCEASGSTGGPMLRARQFSQPSTPAQNGTITAEGVAVIQQFLDGLHDSEGRRVYLN
YQPGSGFTDAATSYDEEAETWGLSISGLGGEWVARYLQLQDTSTLESLDNVTYDTLKEWM
IYGMNKYADSLQTTHPDLSDFHSAGGKVIHVHGESDDSIPAGSSVHYYDSVRSVMFPEKN
YNESVAAVDEFYRLFLVPGGAHCGSNSNQPNGGWPQTTLQTVIEWVEKDVAPETLDGSGG
DIDTICRWPLRPLWSGDSLDCVYDQESLDSWTYDFDAYKMPLY
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgacgatgaatacagatttttgatccaagggcatttgttctctctcaagtca
cccgttcacggtgcttctttgagcgacatatgctccaagacctatgccaagtcggctctt
cccgccgatggcttcatctccggcatcacgatcgacccagactctgttcaaacgactctg
gtctcaaacgccagctttcagtcggaatggtatcctactgctaccgccgactattgcaac
ctcactttcgcctattcgcacgatggcattgacagtgatgtcgttcacgtgtcgtatcta
ctgcccgctcctagcaagctccagaaccgctatgtctctactggcggaggcggccttgct
atcaactctgggagccagtatgctgcttccggacttatagtcggagctgtttccggaatc
accgacggcggctttggatcattcaacacccagtgggatgaggtcttcctcttggccaat
ggcaccatcaactggcagtctgtctacatgtttggttaccaggctcatcacgagcttgcc
ctactcggcaaggagctggcaaggaacctttacaatgtgtccaaaagctccaaggtctac
tcttactatcagggttgttctgaaggaggccgtgagggatggagtcaggtgcagcgtttt
gccgaccagttcgacggtgctgccattggtgctccggccttccgctatggtcaacagcag
gtcaatcatttgttcggcaatgtggttgaacagaccttggattacttccctccttcgtgc
gagttggacaagattctcaacttgaccatcactgcttgtgacggtctggacggaagagag
gatggcgttgtctcgcgctctgatctgtgcaagctcaacttcaatctgaactccacgatc
ggtacggcctactcctgcgaggcatccggttcaacgggcggaccaatgctgcgggcccga
cagttctcccagccatcaaccccagctcagaacgggaccatcacagcagagggtgttgcc
gtgattcaacagttcctcgacggccttcacgattctgaaggtcgccgtgtctaccttaac
taccagcctggatcagggttcacggacgccgccacttcctacgacgaagaggcggagacc
tggggcttgagtatcagcggactcggtggcgaatgggtcgctcgctacctccagctgcaa
gacaccagcactctcgagagcctcgacaacgtcacctacgacacgcttaaggagtggatg
atctacggtatgaacaagtatgcagactctctgcaaaccactcatcccgatctgagtgac
ttccactccgcaggcggaaaggtgatccatgttcacggagaatccgacgactccatcccc
gcggggtcatctgtgcactactacgactctgtccgcagcgttatgttccctgagaagaac
tacaacgagagcgttgccgccgtcgacgaattttacagactcttccttgtccctggtgga
gctcactgtggcagcaactcgaaccagcccaatggtggttggccacagacgactcttcag
acggttatcgaatgggttgagaaggatgtggctcctgaaactctggatggaagcggtggt
gatatcgataccatctgccgttggcctcttcgtccgctgtggtctggtgactctcttgat
tgtgtttatgatcaggagtctcttgatagctggacctatgattttgatgcttataagatg
cctctttactaa

DBGET integrated database retrieval system