KEGG   Nectria haematococca: NECHADRAFT_91747Help
Entry
NECHADRAFT_91747  CDS       T01612                                 

Gene name
HAM2101
Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NECHADRAFT_91747 (HAM2101)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 1077 aa AA seqDB search
MEEELQQSVMVSDEDAEYETAGDIPTMNAMTSDAPDANMGARGASEHMDDDELSDRDASG
EELDIDAEGEEDNDFLLDQQISANNTHEITQAEGHHDEEEGEEEEDDVDAEGEEYDEDEG
VGDVKIQPGQEHDEEASDSERSESPSVIDEESDEDAPWEDAGEADEDEDEDEEAGPSNNC
TFCKQGEDEDPSEEFEVYLACAGCGVNAHQQCARDAAAMSEDNTPENWKCPECYHRDSDV
EEHDEDMDDQSVNHDMELPSQQSDLPDHSGEVRFEPDADDEPLTSQIDDEALPEEPIDET
RTLRKRKSSSLEDDDNVISLRKRRRNQSNEPTSSHEGTTRNGSAEPNRHNPSRTLRLKVT
RPPPVTTEKRTRTSLVLKIQVRPGNLKEILSRKRRDRRPPGSAARPSSHRPAATPRANPI
PTPITALPTPFTSDNYSQPFYSFFDRETDEMKGKPYGGILTEAEADTSKTLPAPEDRRRF
DDANKKAEDEWRARVLAMQADADLPVRKHKKSSENASQIECIEFGGWEIDTWYAAPYPAE
YSRNRVLYICEFCLKYMNSDYVAWRHKLKCPAKHPPGDEIYRHKSVSVFEVDGRKNPVYC
QNLCLLAKLFLGSKTLYYDVEPFLFYVLCEYNDTGYHFVGYFSKEKRASSQNNVSCILTL
PIHQRKGYGNLLIDFSYLLTKVEEKTGSPEKPLSDMGLVSYRNYWRLILCRYFLNVMETE
DHKSEGLSIKRISDDTGMTPDDVISALEGLRALVRDPQTKLYAFRVDVDYCRQYVNKWEA
KGYVQLKPEALVWTPYVMGRSNAVNFELGPPINTIAPREDDEAKVDEGEGVDTVGTESQP
TTNGEGKSVADADTNGEHPLVNGEAAATPVQSIEEVDPDQEEQPGSPKDIEMGDTVEDGP
PAWVLPYKDIPPNRFEVFPAVPGGRRDRSRQSANRPSAPRTVSSASRPKRNGKSHRPSSS
SRPKSASKRKTGGTGRGPGRWPKGTKKSDYGNADSGPGLPPGWLDKQPKLLPITEGNDAE
QEVTGEEPAEDSVVVSTKTNGAPANGDAVEPNGTEAATDGEHHEDDEGDVDAEGEDV
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagagcttcaacaaagtgtaatggtttccgacgaagacgccgaatacgagaca
gcgggtgatatcccgacgatgaatgcgatgacgtccgacgcacctgatgccaatatgggc
gctagaggcgcttctgaacacatggacgatgatgagttgagcgatcgcgacgcttcaggc
gaggaactcgacatcgatgccgaaggcgaagaggacaacgactttctcctagatcaacaa
atctctgccaacaacacccacgaaataacacaagcggaaggccaccatgacgaggaagag
ggagaggaggaggaggatgatgtagacgcggagggagaagaatacgatgaagacgaggga
gtgggcgacgtcaagatccagccgggtcaagagcatgatgaagaagcgagcgacagtgaa
agatcagagtcaccgagtgtgatcgatgaagagtccgacgaggatgccccatgggaagat
gctggggaagctgacgaggatgaggacgaggacgaggaagcaggaccatctaacaactgc
acgttctgcaagcagggcgaagatgaagatccaagcgaggagtttgaagtatacttggca
tgcgcaggttgtggtgtaaatgcacatcagcaatgcgcccgcgacgctgcggcaatgagt
gaggataacacccccgagaattggaagtgccccgaatgctatcatagggattccgacgtt
gaagagcacgatgaagatatggacgatcaaagtgtcaatcacgacatggagctcccctcc
caacaatccgaccttccagatcattctggagaagtacggtttgagccagatgcagatgac
gaacctctgacttctcaaatcgacgatgaagctctacccgaggaacccatagacgagact
cgaacattgcggaaacgaaagtcatcgtccctcgaagatgacgataatgtcatatcgtta
agaaagcgacgacgtaatcagtcgaacgagccaacgtcttcacatgaaggcacaacgcgc
aatggaagcgccgagccaaatcgacacaacccttctcgcacgcttcgtctcaaagtcacg
cgcccccctcccgtcactacggagaaacgtacacgcacatcacttgtcctaaagatccag
gtcagacccggaaatcttaaggaaatactttctcgcaaaaggcgcgacaggcgaccgccc
ggcagtgctgctagaccttcatcccaccgaccagcagccactcccagagccaatcctatt
cctactccgataaccgccctcccaacacctttcacatcagacaactactcacaaccattc
tattccttctttgaccgggagacggacgagatgaagggcaagccatacggcggaatcctc
accgaggcggaagccgacacctccaagactcttccagcacctgaagatcgtcggagattc
gacgatgccaacaaaaaggccgaggatgaatggagagcacgggtcctcgccatgcaggca
gatgccgacctgccagttcgaaagcacaagaagtcgagcgagaacgccagccagatcgaa
tgcatcgagtttggcggctgggagattgacacgtggtatgctgcgccatatccagctgaa
tacagtcggaaccgcgtgctctacatctgcgagttctgtctcaagtacatgaactcggac
tacgtcgcctggaggcacaagctcaagtgtccagctaagcatccgccaggagatgagatc
taccgtcacaagtcggtgtctgtctttgaggttgacggacgcaagaaccctgtgtactgc
cagaacctgtgccttcttgccaagctgttccttggctcgaaaacgttgtactatgacgtt
gagccctttctcttctacgttctatgcgaatacaacgacaccgggtatcactttgttgga
tacttttcgaaagagaagagagccagcagccagaataatgtctcgtgtatcttgacatta
ccaatacaccaacgcaaaggctatggtaacctcctcattgacttttcatacttactcacc
aaggtcgaggaaaagacgggctcgcctgagaagcctctatccgatatgggtctggtgtcg
tacagaaactactggcgtttaattctctgccgctatttcttgaacgtcatggaaaccgag
gaccacaagagcgagggactcagtatcaagcggatatctgacgacacgggcatgacccca
gacgatgtcatctccgccttggaaggcctcagggctctggtcagagatccacagacgaag
ctgtatgcgttcagagtggatgtggactactgtcgacaatacgtcaacaaatgggaggca
aagggctacgtacaactgaagccagaagctctcgtctggacgccgtacgtcatgggtcgc
agcaacgcggtcaatttcgagctgggcccacccatcaacaccatcgcgccgagagaggac
gatgaagcaaaggttgacgaaggagaaggagtcgacacggttggcaccgagagtcaacca
actacaaatggagagggcaagagtgtggccgatgcagatacaaatggggagcatccgcta
gtgaacggcgaagctgcagcaacccctgttcaatccattgaggaggttgatccggaccag
gaggagcagcctggatcacccaaggacattgagatgggagatacagtggaagatgggcca
ccagcttgggttttgccatacaaagatattcctcccaaccggtttgaggtctttccagct
gtccctggtggtcggcgggatcgttcgcggcagagtgccaaccggccatcagcacctcga
accgtcagcagcgcttcaaggcccaaacgcaacggtaagagtcaccggccttcttcatcc
tctagacccaagagcgcctcaaaacgaaaaaccggtgggacgggccgtggacccggccgc
tggccaaagggaaccaagaagtcagactacggaaacgctgatagcggtcctggtctaccg
cctgggtggttagacaagcaacccaagctgctacccatcacggaaggcaacgatgcagag
caggaggtgacgggagaagagccagcggaggactcggtcgtagtctctaccaagacgaac
ggtgccccggccaatggagacgctgtcgagcccaacggcactgaagcagcgacggatggt
gaacaccacgaagacgacgagggtgacgtcgacgccgaaggagaagatgtttga

DBGET integrated database retrieval system