KEGG   Nectria haematococca: NECHADRAFT_92807Help
Entry
NECHADRAFT_92807  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
nhe  Nectria haematococca
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NECHADRAFT_92807
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NECHADRAFT_92807
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NECHADRAFT_92807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 398 aa AA seqDB search
MRGNGKSLTIVIKLGTSSIVDEKTHEPLLPILTLIVDTAVKLRKDGHRVVIVSSGAIGVG
LRRMDVEKRPKHLAQLQALAAIGQCRLMSLWDSLFTHLRQPIAQILLTRNDIADRTRYFN
AQNTFNALLEQGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMIHADMLFLMTDVDCLYD
KNPRTNPDAKPIEVVEDISALQADVSSAGSALGTGGMSTKIIAARLGTSAGVTTIITRSS
NPGNVLNIVRYLQPQQKGHSSPSADEGTSHLTRSASALSLSSSADLTSPPLHTRFVPADD
PIRDRHFWLLHTPYPHGTLYIDSGAYKALLGKAGLLPVGVVDVEGNFAQQEVVRLVVVKR
RTTLGPDGKLWDGIPEEIGPSMSPTGNMLASLEETADP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagaggaaacggaaagtccctcaccatcgtcatcaagcttggaacaagctcaattgtc
gacgaaaagactcatgagccgcttctcccaatcttgacgttgattgtcgacacggccgtc
aagcttcgcaaagatggccaccgggtcgtcattgtttcgtcgggcgccatcggcgttggt
ctccgacgcatggatgtcgagaagcgccccaagcatctcgcacagctgcaggccctcgca
gccattggccaatgtcgtttgatgagtctctgggatagcctgttcacccacctgagacag
ccaattgcccagatcctgctcacaaggaacgatattgcagatcgaacaagatactttaat
gctcaaaacaccttcaatgcccttcttgaacaaggagtgatcccaattgtcaacgaaaac
gacaccttggccgtctcagaaatcaagtttggcgacaatgataccctctctgccatcacc
gctgccatgattcacgccgacatgctattcttgatgacggatgtcgactgtctctatgac
aagaatccgcgaacaaacccagacgccaagccgatcgaggtggtcgaagacatctcagct
cttcaggccgatgtatcgagtgccggctcagccctaggcacaggtggaatgagcaccaaa
atcattgccgccagattgggaacctcggctggtgtcacaaccatcatcacccgatcctca
aacccaggaaatgtactgaatattgtccgatatcttcaaccacagcaaaaaggacactcg
tctccaagcgccgacgaaggaaccagtcacttgacacgctcagcttcggccctatccctc
tcctcttcagcggatctcaccagccctcccctgcatactcgattcgtaccagcggatgat
cccatccgagatcgccatttctggctactccacactccatatccccacggaaccctctat
atcgactcgggagcctacaaggcactcctcggcaaggccggcctgcttcctgttggtgtt
gttgacgtggaaggcaactttgctcagcaagaggttgtgcggctcgtggtggtcaagcgt
cggactacccttggccctgacggcaagctctgggatggcatcccagaagagatcggaccg
agtatgtcgcccaccggcaacatgttggcttctttagaagagacagcagacccgtga

DBGET integrated database retrieval system