KEGG   Nectria haematococca: NECHADRAFT_92925Help
Entry
NECHADRAFT_92925  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nhe  Nectria haematococca
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NECHADRAFT_92925
   00670 One carbon pool by folate
    NECHADRAFT_92925
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NECHADRAFT_92925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 205 aa AA seqDB search
MQPLELTLIVAATRNMGIGAHGTMPWTGLRKEMRYFARVTTRIPPQSPPASLNAVIMGRK
TWDSIPVKFRPLKDRLNIIITRSAGPEDPTPIIGDKEPIRVSSLEHALRYARARTDVARV
FVMGGAQIYAAALELSEARRVLLTSIERDFDCDTFFPIELKGEKSGDWVKKPREELASWT
GEDISEDGEEEAGTKYEFQMWEKID
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctcttgaactcacgctcatcgtcgccgcgacgcgaaatatgggcatcggcgct
cacgggacgatgccctggactggtcttcgcaaggagatgagatactttgcgcgcgtgacg
acacggattccgccccagtcacctcctgcttctctaaacgccgtaatcatgggccgtaaa
acctgggactcgatccccgtcaagttccgacctctcaaagaccgtctcaacatcatcatc
acccgctcagcaggtcccgaagacccaacaccaatcatcggcgacaaagagcccatccga
gtatcatccctagagcacgcgctccggtacgcccgagcccgaaccgacgtcgcacgtgtg
ttcgtcatgggcggtgcgcagatctacgcagcagctctagaactatccgaggcccgacgg
gtgttgctcacaagtatcgagcgtgactttgactgtgacacttttttcccgattgagcta
aagggcgaaaagtccggagactgggttaagaagccgagggaggagctagcgagttggact
ggtgaagacatttctgaagatggtgaggaagaggcggggaccaagtatgagtttcaaatg
tgggaaaagatagattag

  All links  
No link information was found.   
DBGET integrated database retrieval system