KEGG   Nectria haematococca: NECHADRAFT_93940Help
Entry
NECHADRAFT_93940  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
nhe  Nectria haematococca
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    NECHADRAFT_93940
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     NECHADRAFT_93940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 430 aa AA seqDB search
MSIKKSAPSLSGSVWGRTGFGRSWIRSFVAASPCFLAPLTSICVFITLAHICIQYGPRLT
IKGVLAIVCWVGLQALLFRYLPGDTYKGQLTPAGYLLSYRINGLSAWIITHVLYIVLSLA
GVLDPGFIPRNWSSLIGAMNLAGYVISTFAFVKAYIIPTHPEDRKFSGSSLYDFYMGIEL
NPRLGDSFDLKLFSNGRPGMIAWTLIDFSNMAYQYQTQQYIEPSLILITTLQTIYVIDFF
VNESWYLRTIDIAHDHYGFYLAWGCFCFLPTTYTIQGQYLGLYPKSASAPYLAFFFALGL
AGYVLFRSVNHQKDKLRRSAGQCNIWGKPAEYIVASFKTSDGKQHKSLLLCSGWWGWSRH
ANYVGDLFLSFSTCALVGSTRTVVWVYAIWMTMLLIHRCIRDEKRCSAKYGAAWTEYCKR
VPWRFIPGIW
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcgataaagaagtcggcaccatctctcagtggaagtgtttggggtcgcactgggttt
ggcaggtcctggattcgctcctttgtcgcggcatcgccgtgctttcttgcgccgcttacc
tcgatatgcgtctttatcaccctcgctcacatctgcatccaatacggcccgcgactaaca
attaagggagtattggccatcgtgtgctgggttggattacaggccctgctgtttcgatac
ctcccaggcgatacatacaaaggacagctaacccccgctggatatcttctatcttaccgg
ataaatggcctgtctgcttggatcataactcatgttttgtacattgttcttagcctggct
ggcgtattggatcctggcttcatacctcgaaactggagcagtttgattggggctatgaac
ttggctggatatgtcatttcgacgtttgcctttgtgaaggcatacataatacctactcat
ccagaagacagaaagttcagtggatcctcgctctatgacttttacatgggcatcgagctg
aacccgcgacttggcgatagctttgatctcaagctcttcagcaatggtagaccaggaatg
atcgcctggacactgattgacttttcaaacatggcatatcaataccagacacaacagtac
attgagccttctctgattctcatcacgactctccaaaccatatacgtgattgactttttt
gtcaacgaatcttggtatctgcgaacaatcgacattgcccacgatcattacggcttttac
ctcgcatggggctgcttctgtttcttaccaacgacatacactatccaagggcaatacctg
ggtctgtacccgaaatctgcctcggccccttacctggctttcttctttgcgcttggccta
gctggctatgtgctattccgctcagtcaaccaccagaaggacaagctccgccgctctgct
gggcaatgcaacatctggggcaagcccgccgagtacatagtagcgtcattcaagacctcg
gacggtaaacagcacaaaagtctacttctgtgcagtggttggtggggatggtcacggcac
gccaattacgtgggagacctgtttctcagcttcagcacatgtgcgttggttggaagcact
cgaactgtggtctgggtttatgctatatggatgaccatgctgctcatccatcgctgtata
cgggatgagaagaggtgttcggctaagtacggtgctgcatggacggaatactgtaagcgc
gtgccatggcgatttatcccggggatctggtaa

DBGET integrated database retrieval system