KEGG   Nectria haematococca: NECHADRAFT_94728Help
Entry
NECHADRAFT_94728  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
nhe  Nectria haematococca
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 628 aa AA seqDB search
MQSHEGSVAAVYKVRMKEDTPLVTHCALINPDIRADTNRDGVVDLAGDSDAVNKAVWSDA
RGAIFLPNVGDKELRCLNTDRNGIPLSNEELSWCNDASGHLLLAPEYLAPLRTVPLANIS
DDAFAHVYATPREAYERVRIFYLEDAQQPNSTTSWRLVNKQLNFNATQLRDGLVLGIDGR
EFVTEAEVWDGHVTVHFDVYNTPGSKDYVRDSVALKVAPVLTHHPLQRVETLVSTFANDS
EPIQQYFVQQLDDARSVAGIENPLWLFNQSSDIWAQDIVEPAYASMPGPNGPIAIRIMLR
SAQSTRTGGRQVFEQLRGPGIGGFQPADGPGIGFSSSGFGYHTINSYGNLETIPPHRSKD
GTLYKAGRVIQGKHFEEFPAQAVRNLIFGNGVQSALFLETGWLVVGHVDEFVQFLPFDND
LGFTIGIASPDVGIKILSDAQAAGHGNASAISFDAQPQMERFDAEEPPFLNLSVSNLLDN
KTFIEVNRYAQKWIDYNLDILLSEIPLDREDVIHVPALYRDQSGYGPWIRPDGLDYYWPP
VHKDEYQLGAFIPAPINGIVIGNHYLSPNPFGPIINGVDVIARAVTEAYARAGMNVTFVD
DYYSHHMRGGEIHCGSNTLRETAVEWWQ
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagccatgagggctctgtggccgcggtctataaagtcagaatgaaagaagacact
cctctcgttacacactgcgctctgatcaacccggacatccgagcggacacgaaccgtgat
ggcgtggttgatctggcaggcgactcagatgcagtcaacaaggctgtttggagcgatgcg
agaggcgccatctttctccccaatgttggtgacaaagagttgcgttgtttgaacaccgat
cgcaacggaatacccttgagcaacgaggagctgtcctggtgcaatgacgcatcaggccat
cttctgcttgctccagagtatcttgctcctctcaggactgtccctcttgccaacatatcg
gatgatgctttcgcgcatgtctacgctactcctcgcgaagcatatgaaagggtccgtatc
ttttatttggaagatgcgcagcaaccaaactcgacaacttcttggaggctggtgaacaag
cagctcaacttcaacgcaacccagctgcgagatggcctggttctcggaatcgacggccgc
gaatttgttaccgaggctgaagtctgggatggccatgttaccgtccactttgacgtatac
aacacgcctggttccaaagactatgttcgcgactcagtcgctctcaaggtggccccagtc
cttacccatcacccgctccagcgtgtcgagacactcgtcagcacattcgcaaacgactct
gagcccattcagcagtactttgttcaacaactggatgatgctcgctctgtcgccggtatt
gagaaccctctgtggttgttcaatcagtcctctgatatctgggcccaggatattgttgag
ccagcttatgccagcatgccaggccctaatggccccattgctatccgaatcatgcttcga
tcagcgcagtccactcgaactggtggtcgtcaagtctttgaacagcttcgaggccccggc
atcggcgggtttcaaccggcagatggtccaggaatcggcttttcatcttcagggtttggc
taccatactatcaacagctacggcaaccttgagactattcctcctcaccggagcaaggat
ggcactctctacaaagctggtcgagtcattcaaggcaagcactttgaagagttcccagcc
caagcagtccggaacctcatttttggtaatggagtgcaatcggcccttttcctagagact
ggttggttggtagtcgggcacgtcgatgaatttgtccaattcttgccttttgacaacgac
ttgggcttcactattggaatcgccagtccagatgtgggcatcaagatcttaagcgatgct
caagctgccggccacggcaacgcgtcagccatcagcttcgatgcccagccccagatggaa
cgtttcgatgccgaggagccgcctttcttgaacttgtccgtttccaatctcttggataac
aagacgtttatcgaggtgaacagatacgcccagaaatggatcgactacaacctcgatatt
ctcttgtccgagattcctcttgacagggaggatgtcatccacgtccctgcgctctaccgt
gaccaatctgggtatggaccttggatccgacctgatggattggactactactggccccca
gtccacaaagatgaatatcaactgggtgccttcattccggcacccatcaacggcattgtt
attggaaatcactacttgagtcctaacccatttggcccgattatcaacggtgtcgatgtc
atcgctcgagcggttacagaagcgtacgcccgtgctgggatgaacgtcacgtttgtcgat
gattattatagccaccatatgcgtggtggtgagattcactgcggatccaacaccctgagg
gaaactgctgtggaatggtggcagtag

DBGET integrated database retrieval system