KEGG   Nectria haematococca: NECHADRAFT_97581Help
Entry
NECHADRAFT_97581  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
nhe  Nectria haematococca
Pathway
nhe00500  Starch and sucrose metabolism
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NECHADRAFT_97581
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     NECHADRAFT_97581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cellulase CBM_1
Motif
Other DBs
NCBI-GeneID: 9675236
NCBI-ProteinID: XP_003040869
JGI: 97581
UniProt: C7ZL93
Position
12
AA seq 384 aa AA seqDB search
MRYLLPLSGLTGLALAQNGAWQQCGGQNWSGSTTCISGYTCSFINDYYSQCVPGSNPNPP
STTLSTVTQPSSSPTNNPNPGTGKFVWVGTNEAGGEFGEGNLPGTLGKDYIFPDTAAIDT
LIGQGYNTFRVQLKMERLTSTLTGSHNQAYLDGYSKVINHITSKGAYAVLDPHNYGRFFG
NVITDTSAFQTWWKNFAAVFKNNDHVIFDTNNEYHSMDQTLVLKLNQAAIDGIRSTGAKQ
YIFVEGNQWSGAWSWPDVNDNMKALTDPEDKIVYQMHQYLDSDSSGTNEACVSSTIGAER
VKAATAWLKKNGKVGIIGEFAGGANSQCKAAVQGMLDYLEDNSDVWKGVLWWAAGPWWGN
YMYSFEPPSGTGYQYYNSLLKSYV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatctcctcccccttagtggcctcactggtctcgctctggcccagaacggagct
tggcagcaatgcggaggccaaaactggagcggctctaccacttgcatctctggttacact
tgcagcttcattaacgactattacagccagtgtgtgccaggttctaaccccaacccgcct
tctactaccctctctaccgtcactcagccaagctcttctcccaccaacaaccccaaccca
ggaacgggcaagttcgtttgggtcggtaccaatgaggctggtggtgagtttggagagggt
aacctgccaggcactttgggcaaggattacatcttccccgacactgccgcgatcgacact
ctgatcggtcagggatacaacaccttccgtgtgcagctcaagatggagaggctgacgagc
accttgaccggtagccataaccaggcttaccttgatgggtacagcaaggttatcaaccat
atcacctcaaagggtgcctatgctgttcttgatcctcacaactatggccgtttcttcggc
aacgtcattaccgacacttccgcttttcaaacctggtggaagaactttgccgccgtcttt
aagaacaatgaccacgtcatctttgacaccaacaacgagtaccacagcatggatcagact
cttgttctcaagctcaaccaggctgctatcgacggtatccgctccactggcgccaagcag
tacatctttgttgaaggcaaccagtggtctggtgcttggtcctggcccgatgtcaacgac
aacatgaaggctctcaccgaccccgaggacaagattgtctaccagatgcaccagtacctg
gactctgacagctctggcactaacgaggcctgtgtttcctccaccatcggcgccgaacgt
gtcaaggcagctacggcctggctcaagaagaacggcaaggtcggcatcattggcgagttt
gccggtggagcaaacagccagtgcaaggcagccgttcagggtatgctcgactatctcgag
gacaacagcgatgtctggaagggcgttctctggtgggcggctggtccctggtggggaaac
tacatgtacagctttgagcctccaagtggaactggctaccagtactacaactctcttctg
aagagctacgtctaa

DBGET integrated database retrieval system