KEGG   Nectria haematococca: NECHADRAFT_97581Help
Entry
NECHADRAFT_97581  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
nhe  Nectria haematococca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nhe00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 384 aa AA seqDB search
MRYLLPLSGLTGLALAQNGAWQQCGGQNWSGSTTCISGYTCSFINDYYSQCVPGSNPNPP
STTLSTVTQPSSSPTNNPNPGTGKFVWVGTNEAGGEFGEGNLPGTLGKDYIFPDTAAIDT
LIGQGYNTFRVQLKMERLTSTLTGSHNQAYLDGYSKVINHITSKGAYAVLDPHNYGRFFG
NVITDTSAFQTWWKNFAAVFKNNDHVIFDTNNEYHSMDQTLVLKLNQAAIDGIRSTGAKQ
YIFVEGNQWSGAWSWPDVNDNMKALTDPEDKIVYQMHQYLDSDSSGTNEACVSSTIGAER
VKAATAWLKKNGKVGIIGEFAGGANSQCKAAVQGMLDYLEDNSDVWKGVLWWAAGPWWGN
YMYSFEPPSGTGYQYYNSLLKSYV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatctcctcccccttagtggcctcactggtctcgctctggcccagaacggagct
tggcagcaatgcggaggccaaaactggagcggctctaccacttgcatctctggttacact
tgcagcttcattaacgactattacagccagtgtgtgccaggttctaaccccaacccgcct
tctactaccctctctaccgtcactcagccaagctcttctcccaccaacaaccccaaccca
ggaacgggcaagttcgtttgggtcggtaccaatgaggctggtggtgagtttggagagggt
aacctgccaggcactttgggcaaggattacatcttccccgacactgccgcgatcgacact
ctgatcggtcagggatacaacaccttccgtgtgcagctcaagatggagaggctgacgagc
accttgaccggtagccataaccaggcttaccttgatgggtacagcaaggttatcaaccat
atcacctcaaagggtgcctatgctgttcttgatcctcacaactatggccgtttcttcggc
aacgtcattaccgacacttccgcttttcaaacctggtggaagaactttgccgccgtcttt
aagaacaatgaccacgtcatctttgacaccaacaacgagtaccacagcatggatcagact
cttgttctcaagctcaaccaggctgctatcgacggtatccgctccactggcgccaagcag
tacatctttgttgaaggcaaccagtggtctggtgcttggtcctggcccgatgtcaacgac
aacatgaaggctctcaccgaccccgaggacaagattgtctaccagatgcaccagtacctg
gactctgacagctctggcactaacgaggcctgtgtttcctccaccatcggcgccgaacgt
gtcaaggcagctacggcctggctcaagaagaacggcaaggtcggcatcattggcgagttt
gccggtggagcaaacagccagtgcaaggcagccgttcagggtatgctcgactatctcgag
gacaacagcgatgtctggaagggcgttctctggtgggcggctggtccctggtggggaaac
tacatgtacagctttgagcctccaagtggaactggctaccagtactacaactctcttctg
aagagctacgtctaa

DBGET integrated database retrieval system