KEGG   Nectria haematococca: NECHADRAFT_97803Help
Entry
NECHADRAFT_97803  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
nhe  Nectria haematococca
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NECHADRAFT_97803
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     NECHADRAFT_97803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 357 aa AA seqDB search
MAPVFTYADVQSHNTKDDLYLIIRGKVYNASSFINDHPGGSDILLEVAGKDATEAYDDTE
HSEEADEVLEDLLVGILSSDSNSAPQGANQPVTQEPAAQVATKTLQPDHFQEFKLVEKTI
ISHNVAIYRFNLPSPESILGLPIGQHISISAQIPQPDGTSKEVTRSYTPISGDDQPGCFD
LLIKSYPQGNISRYIDTLVPGQNIHVRGPKGSFVYTPNMVRHFGMIAGGTGITPMLQIIN
AIVRGRASGDVTQVDLIFANVNSEDILLKERLDALAKVDAGVRIHYVLNNPPAGWTGGVG
FVGADMVSKWLPKPKNDIKILLCGPPPMISAMKKITQSLGYDAARPASKLEDQVFAF
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcaccggtttttacctacgcagatgtgcaatctcacaacaccaaggatgatctctat
ctgattattcgcggcaaggtttacaacgcttcgtcatttatcaacgaccatcccggcggc
tcagatatcttgctcgaggttgccgggaaagatgccactgaagcctacgatgataccgag
cattctgaagaggccgacgaggtcttggaagatcttctagtaggcattctgagctcagac
tccaactcggcgccacaaggggccaatcagcccgtcacccaagaacctgcagcacaagtc
gcgacgaagactctgcaaccggatcacttccaggagttcaaactcgtggaaaagaccatc
atctcacacaatgtggccatatatcgcttcaacctccccagtcccgagtcaatactgggt
ctaccaatcggccagcacatttccatctctgcccagattccacagcctgatggtaccagt
aaagaggttacacgctcttatacacccatctctggtgatgatcagcctggttgcttcgac
ctacttatcaagtcctaccctcagggaaacatctcccgatatatagacacgcttgttcct
ggccaaaacattcacgtccgtggacccaaggggagttttgtttatacccccaatatggtc
cgccattttggcatgatcgctggtggcacaggaattacacccatgctgcagattatcaac
gcgattgtccgtggtcgtgcgagtggcgatgtaactcaggtggatcttattttcgccaat
gtgaactctgaggatatcttgctgaaagagagactggacgcattggctaaagtcgatgct
ggcgtccgcatccactatgtcttgaacaacccacccgctggctggaccggcggcgttgga
tttgttggagccgacatggtatctaaatggcttcccaagcccaagaacgatatcaagatc
ctgctttgtggaccgcctcccatgatcagcgctatgaagaaaatcacacagagcttggga
tacgacgcggctcgaccggccagtaagttggaggaccaagtctttgcattctag

DBGET integrated database retrieval system