KEGG   Nectria haematococca: NECHADRAFT_98561Help
Entry
NECHADRAFT_98561  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
nhe  Nectria haematococca
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NECHADRAFT_98561
Enzymes [BR:nhe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     NECHADRAFT_98561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 313 aa AA seqDB search
MVDRPNKPSALSATPAAAESTANITHDDSRVSAVLPTGESVEVLLHGATVISWKDASGSE
KLWVSEAAALDGSAPVRGGIPIVFPVFGTAPDHEATSKLRQHGFARNSRWEFLGKSTSEG
SSTSVKLDFGLSSESVSEETKELWPYKFALIYSVVLDRDSLNTTLVITNDGDVPFEFQTL
LHTYFKIDDISSTEVTGLEDSTYISKLAGPEEETQSGAITFAAETDSVYTPVNGPRHPVV
ISESGTPRFRIVRDNLDQVVVWNPWVDKSAGIKDFEPKDGWKKMLCVEPGTVKGWQKLEK
GDAFEASQTITLV
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaccgccccaacaagccctccgccctttccgctacccccgcggccgccgagtcc
accgccaacatcacccacgacgactctcgcgtctcggccgtcctccccaccggagagagc
gtcgaggttctccttcatggagctactgtcatcagctggaaggatgcctcagggagcgag
aagctctgggtgagcgaggctgccgctcttgacggtagcgctcccgtccgaggtggaatt
cccattgtgttcccggtctttggaactgctcccgatcacgaggccacctccaagctccgc
cagcatggtttcgcccgtaactcgcgatgggagttccttggcaagtccaccagcgagggc
tccagcaccagtgtcaagctcgactttggtctgtcttctgagagtgtctcggaagagacc
aaggagctgtggccctacaagtttgctctcatctatagcgttgtgcttgaccgggatagc
ttgaacaccaccctggtcattaccaacgatggtgatgttcctttcgagttccagaccctc
ctgcacacctacttcaagattgacgacatctcctccaccgaggtcaccggtcttgaagac
tcaacctacatttccaagctcgccggcccagaggaagagacccaatccggcgccatcacc
tttgccgccgagaccgactccgtctacaccccagtcaacggccccaggcaccccgtcgtc
atctccgagtccggcacccctcgcttccgcatcgtccgcgacaacctcgaccaggtcgtg
gtctggaacccctgggtcgacaagtctgccggcatcaaggactttgagcccaaggacggc
tggaagaagatgctctgcgtggaacccggaaccgtcaaggggtggcagaagctggagaag
ggtgacgcttttgaggcgtcgcaaacgattactctggtttga

DBGET integrated database retrieval system