KEGG   Nectria haematococca: NECHADRAFT_98639Help
Entry
NECHADRAFT_98639  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
nhe  Nectria haematococca
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:nhe03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 289 aa AA seqDB search
MPPKKWDDEESDDSSSSSSPAAAAAAAAVAARRKFDDEEDDSDASLDMMPRALWRLARLT
RPSSPEREKERKAAEAKAKAAEAAAAAKKPKGQRIAEHQADRAKQKANAASVQVVEETEA
EKRERLRRTEQEADLAHAADMFGDIGISAGRAKTRTAAVIVDSADPTNTVDISKLPLFQP
QTKAQFENLRTVLGPILSANAKNPQYSLFLQDFTKALAKEMPSEQIKKLASTITALGNEK
MREEKAADKGGKKTKAAKTKTSLVTGRANAADTSHYDDDGGDFGDDDFM
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctaagaagtgggacgatgaggagagcgacgatagctcttcctccagctctccg
gctgccgctgccgctgccgctgccgttgctgctcgccgcaagtttgacgatgaggaagac
gatagcgatgcaagtctcgacatgatgccccgcgctctctggcgccttgcaagactaacc
cgaccctcttcgccagagcgcgagaaggagcgcaaggccgccgaggccaaggccaaggct
gctgaagctgccgccgccgccaagaagcccaagggccagcgtattgctgagcaccaggcc
gaccgagccaagcagaaggccaacgccgccagcgttcaagtggtcgaggagaccgaggcc
gagaagcgtgagcgactccgacgtaccgagcaggaggccgatcttgcccacgccgccgac
atgtttggagatatcggaatcagcgctggccgggccaagacccgaactgctgccgtcatc
gtcgactccgccgatcctaccaacactgtcgacatttccaagctgccccttttccagccc
cagaccaaggctcagttcgaaaacctccgcacagttctcggccccatcctttcggccaac
gcaaagaacccccagtacagcctcttcctccaggacttcaccaaggccctcgccaaggag
atgcccagcgagcagatcaagaagctggctagtactatcaccgccctgggcaatgagaag
atgagggaggagaaggctgccgacaagggcggcaagaagaccaaggctgccaagaccaag
acgtcgctggttactggccgtgctaacgctgcggacactagccactacgatgatgatggt
ggtgactttggagatgatgacttcatgtga

DBGET integrated database retrieval system