KEGG   Nectria haematococca: NECHADRAFT_99053Help
Entry
NECHADRAFT_99053  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
nhe  Nectria haematococca
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NECHADRAFT_99053
Translation factors [BR:nhe03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    NECHADRAFT_99053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 746 aa AA seqDB search
MAPSFDHLRDADLDDDEFNEDDIDISDLRERFEVQLEQGYDSFVVIDGLPEVTEEQKPKL
VKFLLKKLNTVGKTREDLVHMPMGDNGKSLRFAFVEYSSPAEAAAATRQLDLVPLDKKHT
LRVNKFTDIERYGREGRVDETYQPPHIDEFTEKEHLRWFLKDPSGRGRDQFVMYKGESVG
VYWNNEKDQPENIVERQHWTETFVQWSPLGTYLTSVHAQGVQLWGGQSWSRQARFAHPFV
NLVAFSPGEKYIVTWSNRPISIPDEGHPALSIDDHGKNYVIWDIATATPLRSFANLDAPK
GEEGKPPPKMQWPAFKWSADDKYVARLTQGQSISVYELPRMNLLDKTSIKIEGVMDFDWA
PATPKRDSIKTYEQLFCYWTPEIGSNPAKVGLMSIPSKQVVRSLNLFSVSDAKLHWQSEA
AYLCVKVDRHSKSKKSQATTLEIFRVKEKGVPVEVVDTIKDTVINFAWEPKGDRFSIITT
TEPVGVTAVPPKTAVSFFCPEKAKGQQVGNFKHLRTLDKKNSNAIYWSPRGRFVVIATIA
NTQSSDLDFFDLDFEGEKPEAEKDLTANLQHMNTADHYGVTDVEWDPSGRFVATWASAWK
HSMENGYHIYDFRGEALREEPLEKFKQFSWRPRPATMLTKEEQKAVRKNLREYSRVFEQE
DADRGASADLAVVEARRNMLQEWYNWREEVEADTFEEREVLGLPKDPHVPLLEAYTKSLE
GTTSEADRVIEEIVEEVLEESEEVVG
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctccttcgaccacctccgcgatgccgatctcgacgatgacgagttcaacgag
gatgacattgatatttccgacctgcgagagagattcgaggtgcagctggagcagggttac
gacagcttcgtcgtcatcgacggccttcccgaggtcacggaggagcagaagcccaagctc
gtcaagtttttgttgaagaagctcaacacagttggcaagacacgggaggatctggttcac
atgcccatgggcgacaacggaaagtctcttcggtttgcttttgttgagtactcttcgccc
gctgaggctgccgctgccactcgccagctcgacctggttcccctcgacaagaagcacaca
ctgcgcgtcaacaagttcaccgacatcgagcgatatggacgagaaggccgagttgacgag
acctaccaacccccccacattgacgagttcaccgagaaggagcatctccgatggttcctc
aaggatccttctggtcgaggccgtgatcagtttgtcatgtacaaaggcgaaagcgtcggt
gtctactggaacaacgagaaggaccagcccgagaacatcgtcgagcgacaacactggact
gagacctttgttcagtggtctcctctcggtacctacctgacctctgtccacgcccagggt
gttcagctctggggcggacagtcctggtcccgacaagcccgatttgcccaccctttcgtc
aacctcgtcgccttctcgcctggtgagaagtatatcgtgacctggtctaaccgccctatc
tcgattcctgacgagggtcaccccgcgctttcgattgacgaccacggcaagaactatgtc
atctgggacattgcgactgctactcctcttcggtcctttgccaacctcgatgcccccaag
ggcgaggagggcaagccgccacccaagatgcagtggcctgctttcaagtggtccgccgat
gacaagtacgtcgcccggttgacccagggccagtccatctccgtctacgagctcccccgc
atgaacctcctcgacaagacctcgatcaagattgagggcgttatggactttgactgggcc
cccgcaactcccaagcgtgacagcatcaagacctacgagcagctgttctgctactggaca
cccgagattggcagcaaccccgccaaggtcggattgatgagtattccctcaaaacaggtc
gtccgatccctcaacctcttcagtgtcagcgacgccaagctccactggcaatctgaggcc
gcctacctctgtgtcaaggtcgaccgacactccaagtccaagaagtctcaggccaccact
cttgagatcttccgcgtcaaggaaaagggtgtccccgttgaagttgtcgacaccatcaag
gataccgtcattaactttgcttgggagcccaagggcgaccgcttctccatcatcaccaca
accgagcccgtgggtgtcaccgccgtccctcccaagactgccgtttccttcttctgcccc
gagaaggccaagggtcagcaggtgggcaacttcaagcacctccgaactctcgacaagaag
aatagcaacgccatctactggtcacctcgaggtcgctttgttgttattgccaccattgcg
aacacccagagctctgaccttgactttttcgatctcgactttgagggcgagaagcccgag
gccgagaaggacctcaccgccaacctccagcacatgaacactgccgaccactacggcgtg
acagacgttgagtgggacccttcaggccgattcgtcgccacctgggcctctgcctggaag
cactcgatggaaaacggttatcacatctacgacttcaggggcgaggctttgcgagaagag
cctcttgagaagttcaagcagttctcttggcgcccccggccagcgaccatgcttaccaag
gaggagcagaaggctgttcgcaagaacctccgagagtacagccgcgtctttgagcaagaa
gatgctgaccgtggcgcgtccgccgacttggctgtggtggaggcccgccgcaacatgctc
caggagtggtacaactggcgcgaggaggttgaggccgacacatttgaagagcgtgaggtg
ctcggcctaccaaaggatcctcatgttcctctgctagaggcttacacaaagagcctggag
ggtacaacgtcagaggcggatcgggtgatcgaggagattgtggaggaggtgctcgaggag
agcgaggaggttgtcggttag

DBGET integrated database retrieval system