KEGG   Nectria haematococca: NECHADRAFT_99118Help
Entry
NECHADRAFT_99118  CDS       T01612                                 

Definition
glycoside hydrolase family 13
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
nhe  Nectria haematococca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NECHADRAFT_99118
Enzymes [BR:nhe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     NECHADRAFT_99118
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     NECHADRAFT_99118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 1554 aa AA seqDB search
MSPPHTMTSNEVYLLPLNDDGSPQVPGEYIYLAPRSNDAITIRFAIEGTSSICRHGSLWV
NIPDEDQEFRRDKFREYKLTPDFNRTLEISIPIHQPGAYAFYTTYAELPDLKKELEDSSD
QKENLKKTPLYYIDVAPRLQLDGRPLPLPALSIFSVISKFMGKYPNDWERHLGGISDRGY
NMIHFTPLQVRGESNSPYSLYDQLGWDPSCFPKGEEDVQKMVASLEQNHSLLSLTDIVLN
HTANNTKWLEEHPEAGYNLTTAPWLEPAYQLDTKLLELSENLEKLGLPTELKSSEDLLLI
MNAIKTEVVAKIRLWEYYALDVDRDADATVEALSKGSLHTPEDSAEFEKQLQKAKAAPVK
DQVTFMREFGLAGTDRMGERFRRRVKPDVAASFLSSVLESPDDATARAKIVEILDILNVD
FYKEYDSEVDDILQQIFNRIKYVRLDEHGPKLGPINEANPLIETYFTRLPANATTSKHKP
EDLALVNNGWVWGGNALVDNAGPASRVYLRREVIVWGDCVKLRYGSSPEDNPWLWEHMTK
YARMLAKYFAGLRIDNCHSTPIHVAEHILDEARRVRPDLYVVAELFTGSEEMDYVFVKRL
GLSSLIREAMQAWSTGELSRLVHRHGGRPIGSFEVDEVSKSDVRTPSGSPTSPKASDTNG
SGPFSREIVRTVKPSPVHALFMDCTHDNETPAQKRDARDTLPNAALVCMCSSATGSVMGY
DEIYPKLVDLVNETRLYTSASSGPKPIKIGGGEDGIGGVKKLLNQIHTLMGKDGYDETHI
HHEDQYITVHRVHPESRKGYFLIAHTAFPGYGNGNGAFSAVHLSGTKARHLGSWMLEVDA
SEETTKRILEDKKHLRGLPSRVKDLPGIRMEIKGDDTIITVRDKFPPGSIALFETWIPAA
EHSSGLDNYVTSGAKAAWNELNLSDLNYLLYRCEAEERAESDGRDGVYDIPGHGKLVYAG
LQGWWSLLKDIIRDNNLAHPLCQNLRDGQWALDYILARLQRISAIPGNEAMAQPLTWLKE
RFDAIRKIPSFLLPRYFGLVLRTAYMASWERSLELMNASVRDGQWFLQSLAMVSVQQVGY
VKSASLWPNKLVPSLAAGLPHFAVEWARCWGRDVFISLRGLLIGTGRFDDAKEHILAFAS
VLKHGMIPNLLSSGDAPRYNSRDSIWFFLQCIQDYTRFAPEGVGILKAKVKRRFLPYDDT
WFPTDDSRAYSKESTIEEVIQEALQRHASGMKYREANAGPQIDSQMKDEGFNQDIKVDWE
TGIIFGGNQFNCGTWMDKMGESERAGSKGVPGTPRDGAAIEITGMLYSTLNWLAGLNEKG
QYAYASVDKSDGGSISLANWAGLVKANFERCYYVPLSPEDDSKYDVNTPIVNRRGVYKDL
YKSGKEYEDYQLRPNFAIAMTTAPDLFDPAHAMHALCLADEVLRGPQGMATLDPADLNYR
PYYINSEDSDDFATSKGRNYHQGPEWIWPTGFFLRALLKFDLKRRTTPEGRTEAFQQVTR
RLSGCKKMIQESPWAGLQELTQKNGEYCPDSSPTQAWSAGCLIDLYMDAVEEQK
NT seq 4665 nt NT seq  +upstreamnt  +downstreamnt
atgagcccaccgcacaccatgacgtccaacgaggtctatctgctgccgctcaacgacgat
ggctcgcctcaggtgccgggcgagtacatctatctggctcccaggtccaatgatgctatc
acgatacgctttgctatcgagggcacgtcgtccatttgtcgtcatggcagcctctgggtc
aacatccccgacgaggatcaggaatttcgtcgcgacaagttccgcgagtacaagctcacg
ccagacttcaatcgcacactcgaaatctccattcccattcaccagcctggagcctatgca
ttctacacgacctacgccgagctccccgacctcaagaaagagctagaagacagctctgac
cagaaggagaacctcaagaagacccctctgtactacatcgatgttgcgcccagactccag
cttgacggcaggccgttgccgctgcccgccctgtcgatcttctcggttatcagcaagttc
atgggcaaatatcccaacgactgggagcgtcacctcggtggcattagtgatcgcggctac
aacatgatccacttcactcctctacaggtgcgcggagagtccaactcgccctacagcttg
tacgaccaacttggctgggacccttcttgttttcccaagggcgaggaggacgtccagaag
atggtagccagtctcgaacagaaccactccctgctcagcttgaccgacattgtgcttaac
cacacggcaaacaacaccaagtggttagaagagcaccccgaggccggctacaacctcact
acggctccctggctggagcctgcttaccagcttgacacaaagctcctggagctgagtgag
aacttggagaagcttgggttgccaaccgagctcaagtccagcgaagatctgctcctaatc
atgaacgcaatcaagacggaggttgttgccaagatccgactgtgggaatactacgccctc
gatgtcgaccgagacgccgatgcgacggtcgaagctctctccaagggaagcctacacaca
cccgaagactcggccgagtttgagaagcagctccaaaaggccaaggcggcgccggtcaag
gaccaggtcacctttatgagagagtttggtttggctggtacagatcgcatgggagagcgt
ttccgcagaagagtcaagccagatgtcgctgcaagcttcttgtcctctgttttagagtcc
cctgatgatgccacagcaagagccaagattgtcgagatcctggatattctcaacgtggac
ttttacaaggagtatgactccgaagtggacgatatccttcagcaaatctttaacaggata
aaatatgtccgacttgacgagcatggccccaagctgggtcccatcaacgaggccaacccc
ctgatcgagacatactttactcgacttcctgccaatgctacaacatccaagcacaagccc
gaagaccttgccttggtcaacaatggatgggtttggggtggcaatgcgctcgttgataat
gcgggccctgcttcgcgagtctaccttcgccgagaagttattgtctggggtgattgcgtc
aagctgcgatatggctcgagccctgaagacaacccctggctatgggagcatatgaccaag
tatgctcgcatgctggccaagtactttgctggtcttcgcattgacaactgccactctacc
cctatccacgtcgctgagcacatcctggacgaggcccgccgggtgcggccagatctatat
gtagtcgctgagctgttcactggatctgaggagatggattatgtctttgtgaagcgtctc
ggcctcagctctcttatccgtgaagctatgcaggcctggagcacgggtgaactcagccga
cttgtgcacaggcacggtggccgacctattggtagctttgaggttgacgaggtctccaag
tcagacgttcgcacgccttcgggaagtcctacgagcccaaaggccagtgacaccaacggt
tctgggcctttctccagagagattgtccgaacagtcaagccgagcccagtacatgccctg
ttcatggactgcacccacgacaacgagacaccagctcaaaagcgtgatgctcgagatacc
ctgcccaacgcagcccttgtctgcatgtgctcaagtgccactggcagtgttatgggctat
gacgagatttacccgaagctcgtggatctagtgaacgagactcgcctctacacatcagca
tcgtctgggcccaagcctattaagatcggaggcggcgaggatggcattggcggtgtcaag
aagttgctcaaccagattcacactctgatgggcaaggacggttatgatgagactcacatc
caccatgaggaccagtacatcaccgtccaccgagtccaccccgagtcccgaaaaggttac
ttcctcattgcccataccgcattccccggttacggcaatggtaacggtgcctttagtgct
gtacatctcagtggcaccaaagcccgtcatctgggcagctggatgcttgaggttgacgcc
agcgaggagacgaccaagcgaatccttgaggacaagaagcatctgcgtggtctgcccagc
cgagtcaaggacctgccaggaattcggatggagatcaagggcgacgacaccatcatcacg
gtgcgcgacaagttccctccgggaagtattgcactctttgagacatggatcccagcggcg
gagcactcctcgggtctggacaactacgtcacctctggagccaaggctgcatggaatgag
ctcaacctgtctgacctcaactaccttctttaccgatgtgaggctgaagagcgagccgag
agcgatggccgggatggtgtatacgatatccccggacatggaaagctcgtctacgctggt
cttcagggatggtggagtcttctcaaggacattatccgagacaataacctggctcatccg
ctgtgtcagaaccttcgtgatggtcagtgggcgttggactacatcttggcccgactgcaa
agaatcagtgccattcccggaaacgaggccatggcgcagcctttaacgtggctgaaggag
cggtttgatgctatcaggaagatcccaagcttcctgctccctcgttactttggcctggtg
ctgcgcactgcctacatggccagctgggagaggtctctggagctcatgaacgcgagcgta
agagatggacaatggttcttgcaaagcctggccatggttagtgtccagcaggttggatac
gtcaagtcggcatctctgtggcctaacaagctggtaccttctcttgctgctggccttcct
cactttgccgtggaatgggcgcgatgctggggacgagatgtcttcatctctctccgtggt
ctcctcatcggcaccgggcgtttcgatgatgccaaggagcacattctggcctttgcgagt
gtgttgaagcatggcatgattcccaacctcctgagcagtggtgatgcgcctcggtacaac
tctcgagattcgatctggttcttcctccagtgcatccaagattacacacgatttgcccct
gagggtgtcggcatcttgaaggccaaggtcaagcgtcgcttcttgccttacgatgacact
tggttccccaccgatgattcgagggcgtattcaaaggagagcaccatcgaagaggtcatc
caggaggcgcttcaaagacacgcttcgggtatgaagtaccgagaagccaacgctggtcct
caaatcgattctcagatgaaggatgagggcttcaaccaggacatcaaggtcgattgggag
actggtatcatcttcggaggcaaccagttcaactgcggcacatggatggacaagatgggt
gaaagcgagcgtgctggttccaagggtgttcctggaactcctcgtgatggcgctgctatt
gaaatcacgggcatgctctacagcactctcaactggctagccggactcaacgagaagggc
cagtacgcatatgccagtgtggacaagtctgatggtggctccatctcgctggctaactgg
gcaggattggtcaaggccaactttgagcgatgctactatgtgcccctgtcacctgaagat
gattccaaatacgacgtcaacacccccatcgtcaaccgccgcggagtctacaaggacctc
tacaagtcgggcaaggagtatgaggactaccagctgcgccccaactttgccattgccatg
accacggcgcccgacctgtttgatcctgcccacgccatgcacgctctgtgcctcgctgac
gaggtcctccgaggccctcaaggaatggccacactggatcccgcagacctcaactaccgg
ccttactacatcaacagcgaggacagtgatgactttgccacgagcaagggacgaaactac
catcagggacctgagtggatatggcccacgggcttcttcctccgtgctctgctcaagttt
gacctcaagaggcggacgacgcctgagggtcgcactgaggctttccagcaagttactcga
cgcctcagtgggtgcaagaagatgatccaggagagtccctgggccggtcttcaggagttg
acccagaagaatggagaatactgcccagattcgagccccacacaagcttggtcggccgga
tgtctcatcgacttgtacatggatgccgtggaggagcaaaagtag

DBGET integrated database retrieval system