KEGG   Nitrosococcus halophilus: Nhal_0144Help
Entry
Nhal_0144         CDS       T01198                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nhl  Nitrosococcus halophilus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:nhl01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:nhl01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(156134..157303)
Genome map
AA seq 389 aa AA seqDB search
MFLGLFELSFWGYLAVSLLLTHITITGVTVYLHRHQAHRALDLHPVLSHFFRFWLWLTTG
MVTKEWAAVHRKHHAKCETEEDPHSPQLVGIHKVLWQGASLYRVAARNPEVTEKYGHGTP
DDWMERNLYTKHSSAGIVLMLLINVGLFGVPGLLIWAIQMHWIPFFAAGVINGLGHYWGY
RNYEVADASTNLFPWGILIGGEELHNNHHAYGSSAKLSSKWYEFDIGWMYIRLFQALKLA
RVKKVAPKLLIRPEKQWVDLDTARAVVAHRFHLMTSYGRKVMLPVLKEEAAHFSGNELYR
RARNWLVRHEALVDAKARQELKALLEESHRLETVYRFRQQLQEIWSQAWSSQEALLQALQ
DWCKRAEESGIKALQDFALSLRGYSLQQA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgggtcttttcgagttatctttttggggttacctcgccgtcagcctgctgctc
actcacattacgataacaggtgttaccgtttaccttcatcgccatcaagctcaccgggca
ttggatcttcatccggtactcagccacttcttccgtttttggctctggctgaccaccggc
atggtcaccaaggagtgggccgcggtgcaccgtaaacaccacgccaagtgtgaaaccgag
gaagatccccatagcccacaactggtgggcattcataaagtattatggcagggcgcttcc
ctttaccgggtggcggcgagaaacccggaggtaacggaaaaatacggccatggaaccccc
gatgattggatggaacgcaacttatatactaagcatagtagcgcgggcattgtactcatg
ttattgattaatgtggggctatttggggtccctgggttgttgatatgggctattcagatg
cattggattcccttctttgcggcgggagtgattaacgggctgggccattactggggctat
cgtaattatgaagtggccgatgcctccaccaatcttttcccctggggcattctcatcggg
ggtgaggagctgcataacaaccatcatgcttacggcagttcggccaagctctcctccaag
tggtatgagtttgatattggatggatgtacattcggctatttcaggcgttgaaattggcc
cgggtgaaaaaggtcgcccccaagttgcttatcaggcccgagaagcagtgggtggatttg
gacacggcccgggcggtggtggcgcaccgcttccatctgatgacctcctatggccggaag
gtgatgctgccggtgctgaaagaggaagccgcccacttctcaggcaacgagctgtatcgg
cgggcccggaattggctggtacgccatgaggctttagtggatgccaaagcccggcaggag
ttgaaagcccttttggaagaaagccatcgcttggagacggtgtaccgtttccgccagcag
ttgcaggaaatctggtctcaagcttggtctagccaggaggcgttattacaagccctgcag
gattggtgtaagcgggccgaggagtccggcatcaaggccttgcaggatttcgccctgtct
ttgcggggatattccctccagcaggcttag

DBGET integrated database retrieval system