KEGG   Nitrosococcus halophilus: Nhal_0177Help
Entry
Nhal_0177         CDS       T01198                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nhl  Nitrosococcus halophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Nhal_0177
Enzymes [BR:nhl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Nhal_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
189995..190594
Genome map
AA seq 199 aa AA seqDB search
MIGRLRGVLLEKRAPFLLLEVQGVGYELEAPMSTFYVLPDRGAEVILYTHLVVRDDAHLL
YAFASEKERELFRNLIRVNGVGAKLGLAILSGIEVESFTRCVQEGDTASLTRLPGVGKKT
AERLIVEMRDRLFDGPREEMAGVLPRVGSGQVPTSDAVSALVALGYKSQDASRMVRQLNT
EGLATEEIIRQALQRMLKS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattgggcgcctgcggggtgttttgttggaaaaacgggccccctttttgctactagag
gtgcagggcgtgggttatgagctagaagcgcccatgtccactttttatgtgcttcctgat
aggggcgctgaagtaatcctatacactcatttggtggtgcgggatgatgcccatttgctc
tatgcttttgccagtgaaaaggagcgcgaactgttccgcaatcttattcgggtcaatggg
gtgggggctaaattgggattggctattctttccggaattgaggtcgaatctttcacccgc
tgtgttcaggaaggagatacggcgagtctgacccggttgcctggtgtgggtaagaaaacg
gcagagcgcctcattgtggagatgcgggatcggctcttcgatgggcccagggaggagatg
gccggcgtactccctcgggtgggctctggccaggtgccaacctccgatgcggtcagtgcc
ttggtggccctaggctataaatcccaggacgctagccgaatggtgcgccaactgaatacc
gaaggactggcaactgaagagatcatccgtcaggccctacagaggatgctgaaatcatga

DBGET integrated database retrieval system