KEGG   Nitrosococcus halophilus: Nhal_0308Help
Entry
Nhal_0308         CDS       T01198                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nhl  Nitrosococcus halophilus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Nhal_0308
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Nhal_0308
Enzymes [BR:nhl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Nhal_0308
Lipid biosynthesis proteins [BR:nhl01004]
 Desaturase
  First
   Nhal_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
310074..311102
Genome map
AA seq 342 aa AA seqDB search
MTPETAMEINPMSDRKQDILASRYEVARFRPVRQRRWWSLLRWFDSSLTTGLQEGDGTRI
DGIRVLPFLLLHLSCLGVLWVGWSPTAIAVAVALYGIRMLAVTAFYHRYFSHRAFKTSRG
AQFVFALLGASAVQRGPLWWASHHRHHHRYADQKQDSHSPLQEGFWWSHMGWFLSRANFP
PKLKAVPDLVRYPELRFLDRFDALVPALLALSLYGVGEGLGAMTPELGTNGLQLLVWGFG
ISTVVLYHATFTINSLAHRFGSRRYATSDNSRNNFWLALLTFGEGWHNNHHYFPGAVRQG
FRWWEIDFTYYFLRLLAATGLIWDLKQLPAKSRGGWSGTARS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgactcccgagacggctatggaaatcaatcccatgtctgacaggaaacaggatatttta
gcttcccgctacgaagttgcccggtttcggccggttcgtcagcggcgctggtggtctcta
cttcgttggtttgatagcagcctcaccacgggtttgcaggagggcgatgggacccggatt
gatgggattcgggtcctgccgtttttgcttttgcatttgtcctgcttgggggtgctgtgg
gtggggtggagccccacggcaatcgccgtggcggtagccttatatgggattcgtatgttg
gcggtaacggccttttatcaccgctatttttcccaccgggccttcaagacttcccgggga
gcccagtttgtgtttgcccttttgggagcctccgcggtgcagcggggccccctgtggtgg
gcgtcccaccatcgccaccatcaccgctatgcggatcaaaagcaggatagccactccccg
ctccaggagggattttggtggagccacatgggatggtttctctctagggccaattttccc
cccaagttgaaagccgttccggatctggtgcgctatcctgaactgcgtttcctggatcgc
ttcgatgccctggtgccagcccttctggccctttccctctatggagtgggggagggattg
ggagcaatgaccccggaacttggcactaatggtctccagttattggtgtggggctttggg
atttccaccgttgtgctttatcacgccacctttaccatcaattccttggcccatcgtttt
ggaagccggcgttacgctacttcggataacagccgcaataacttctggctggccctgctg
accttcggtgaagggtggcacaacaaccatcattattttcccggcgcggttcggcaggga
ttccggtggtgggaaattgattttacttattactttctgcgcctgctggccgccactgga
ttgatctgggatttgaagcaattgccggccaaaagccgtggcggttggtcaggcacggct
cgctcctaa

DBGET integrated database retrieval system