KEGG   Nitrosococcus halophilus: Nhal_0485Help
Entry
Nhal_0485         CDS       T01198                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nhl  Nitrosococcus halophilus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:nhl00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nhl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495969..497540
Genome map
AA seq 523 aa AA seqDB search
METAEETAKEGQGTIMAESGDRSCWLSDLLAGLVSVGTAQDRRINRLSLDSRRVGPGTLF
FACRGTRQSGHDYIGAAVGKGAVAVAYDPIIPLSSVVHAGLQAQDVPLIALPDLGARLGV
IADRFYLRPSQQLCVMGVTGTNGKTSVSHFLAQALHQQEAPCGLIGTLGVGLMGALKPSQ
LTTPDAVTVQEQLAVTRAAGGRYAVMEVTSHALEQGRVNGVIFNTAIFTNLSREHLDYHG
DMTRYGAAKFRLFGQPGLRHAVINVDDTAGEAFLAHLPAEVTVISYGLTNPQASLRVNEL
HCDRRGIVMNIQGPWGEGELICPLLGRFNAYNLLAALGGLLTTGMPFTEALQRLSQVQAV
AGRMEPMGGAAGEPLLVVDYAHTPDALEQALCSLRAHLEPGARLWCVFGCGGNRDRGKRP
LMGAVAERWADFVMLTDDNPRDEDPRQIIIEILSGMEAPDRVYQLRDRAEAISRAVELAG
SKDIVLIAGKGHEEYQQVGTEQRPFSDREQAQQALQQRRRGLC
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggaaacggcggaggaaacggcaaaagaaggacaggggacgataatggcggagtctggc
gatcggagttgctggttaagcgatttgctggcggggctggtgtctgtcggaacagcccag
gaccggcggattaatcgcttgtctctagatagccgccgagtcggtccagggacgctattt
tttgcttgccgaggaacgcggcagtcgggccacgactatatcggcgccgctgtgggtaag
ggggctgtggcggtcgcctatgatccgatcattcccctttcctccgttgttcacgcgggg
ctacaagcccaagatgtccctctaattgccctgcctgatttgggcgctaggctgggggtg
attgctgatcggttttaccttcggccgtcgcaacagctctgtgtcatgggggtgacgggc
accaacggtaagacttccgtcagccattttttagcccaagcccttcaccagcaggaggct
ccttgcgggctaatagggaccctcggtgtgggcttgatgggtgcccttaaacctagccaa
ctgaccactccagatgccgtgaccgtgcaggaacaattggcggtaacgagggctgccggg
ggccgttatgcggtgatggaggttacctcccacgccctggagcaagggcgggtcaatggg
gtgatttttaataccgctatctttaccaacttaagccgtgagcatcttgattatcatggc
gatatgacccgctatggggctgccaagtttcgactctttgggcagcctggattacgccat
gccgtcatcaatgtggatgataccgcaggggaggcgtttttagcccaccttcctgccgag
gtcaccgttatcagctatggattgaccaatccccaggccagccttcgggtcaatgaactc
cattgtgatcgccgcggcatcgttatgaacattcaaggaccctggggggaaggcgagttg
atttgtcccttactgggccgcttcaacgcttataacctccttgctgccctgggtggttta
ttgactacggggatgccgtttaccgaggcgttgcagcgcctttcccaagtccaggcagtt
gcgggacgcatggagcccatggggggggcggcaggggagcctttattggttgtggactat
gcccataccccggatgccctagagcaggctttgtgctctttgcgggcacacttagagccg
ggggcacggttatggtgtgtcttcggttgcggggggaatcgggatcggggtaaacgtccc
ttgatgggggcagtggctgaacgttgggctgattttgtgatgctgaccgacgacaatccc
cgggatgaggacccccgccaaattattattgagattctttcgggcatggaggcgccggat
agggtgtaccagctcagggaccgggctgaggcgatcagtcgcgccgtggaattggcaggg
tctaaggatatcgtgcttattgcgggaaaagggcacgaggaatatcagcaagtcggtacc
gagcagcgcccctttagcgaccgggagcaagcgcagcaggcgttgcagcagcggaggaga
gggctgtgctga

DBGET integrated database retrieval system