KEGG   Nitrosococcus halophilus: Nhal_0701Help
Entry
Nhal_0701         CDS       T01198                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nhl  Nitrosococcus halophilus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nhal_0701
Enzymes [BR:nhl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Nhal_0701
Peptidases [BR:nhl01002]
 Cysteine Peptidases
  Family C44
   Nhal_0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
707538..709532
Genome map
AA seq 664 aa AA seqDB search
MCGFGGFYDSSLPADRAEHILTKMASCLVHRGPDDQGIWLERETGIHLAHRRLAVVDLSA
SGHQPMQSASGRYVMAFNGEVYNYQTLRAELEQRGTQWRGHSDTEVLLAGIETWGVGETL
RRCVGMFALALWDRKARVLYLARDRLGEKPLYYGWMKGAFLFGSELKALRAHPAWQGEIE
RKAVTLFMRHNYIPTPFSIYKGIYKLPPGCFLALPWEALTAGKAPTPFPETEGSGGQMIA
PVAYWSAWEAVEKGGAAPFRGSDEEAIAELEERLREAVAGKMVADVPLGAFLSGGIDSSM
VAALMQAQSSQPVKTFSIGFHEQGYNEAVHAAQVARHLGTDHTELYINPQEAMAVIPRLP
TLYDEPFADSSQIPTFLVSQLARRHVTVALSGDGGDELLGGYNRYFWCRRIWSKVGRIPR
FARQMAAQGLRLPPPRVWDRVFASAGPFLPARLRQVHPGDKLHKLAAVLASDSPAVIYEQ
LISQWQNPSSIVINGSETSGIADKVWSHLTLTDLTERMMFLDLMTYLPDDILTKVDRASM
AVSLEVRVPLLDHRLVEFAWRLPVGLKVREGAGKWMLRQILHRYVPKELVERPKMGFGVP
IDIWLRGPLRDWTEDLLDESKLKREGYFHPGPIRQKWEEHLTGRRNWQYPLWCVLMFQAW
LEAQ
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggctttggaggattctatgattcttcgctgccggcggatcgggctgagcatatc
ctcactaagatggcctcgtgcttggtccaccgggggccagacgatcaggggatctggctg
gaacgggagacgggaattcatctcgctcataggcgcttggcggtggtggatctttctgcc
agcggtcaccaacctatgcagtctgctagtggtcgctatgtgatggcctttaatggggag
gtatataactatcaaacacttagggcagagctagaacagagaggaactcagtggcgcggc
cactcggatacggaagttttgctcgcggggatcgagacttggggggtgggtgaaaccctg
cggcgctgtgtggggatgtttgccttggccctctgggatagaaaggcgcgggtgctttat
cttgcccgggatcggctaggagagaagcccttatattatggttggatgaagggggccttt
ctgtttggctccgaactgaaggcgctcagggcgcaccctgcctggcagggggagatagag
cggaaagcagtgaccctttttatgcgtcataactatatccccacccctttttctatctat
aaaggaatttacaagcttccgccaggatgttttttagctttgccttgggaagccttaaca
gcaggtaaggctcccaccccctttccagagacggagggctcaggaggccagatgattgca
ccggtggcctattggtctgcctgggaagcggtggaaaagggaggcgcagccccttttagg
ggcagtgatgaagaggccatcgctgagttggaggagcggctacgggaagccgtggcgggt
aagatggtagccgatgtccccctgggggcctttctctctggagggattgattcctcaatg
gttgccgccctcatgcaagctcaaagcagtcaacccgtcaaaactttctccattggtttc
cacgagcagggctataatgaagcggttcatgctgcccaagtggcccgccatttaggtacg
gatcataccgagctttatatcaacccccaggaagccatggccgtgatccctcggcttcca
accctctatgatgaaccttttgccgactcctctcagattcccacttttctggtgtcccaa
ttggcacggcggcatgtcaccgtggccctgtctggggatggaggcgatgagctattgggg
gggtataaccgctatttctggtgtaggcggatctggagcaaggtggggcggattcctcgc
tttgcgcgccaaatggctgcccaagggttgcggcttcccccgccccgggtttgggaccgg
gttttcgcaagcgcgggtccttttttaccggcccggctccggcaagtccatccgggcgat
aaattgcacaagctagcggccgttttggcttcggattctcctgccgtcatctatgaacag
ctcatttcacaatggcaaaaccctagtagtattgtcatcaatggttctgaaacctcaggt
attgcggataaagtgtggtctcatcttaccctgaccgaccttaccgagcgcatgatgttc
ctggatctgatgacctatcttcccgatgatatcctgaccaaggtggaccgggccagtatg
gcagtgagtttggaagtccgggttccgttgctggatcatcgcctggtggagtttgcttgg
cgccttccggtagggctgaaggtgcgggagggggcaggcaagtggatgttgcgccagata
ttacaccgctatgttcctaaggaattggtagagcgtccgaagatgggcttcggggtgcct
attgacatttggttgcgtgggccgttgcgtgactggacagaggatttgcttgatgaaagc
aaactcaagcgagaagggtatttccaccctgggcctatccgccaaaaatgggaagagcat
ctcaccggacggcgtaactggcaatatcccctctggtgcgtcttaatgtttcaagcatgg
ttggaagctcagtaa

DBGET integrated database retrieval system