KEGG   Nitrosococcus halophilus: Nhal_0707Help
Entry
Nhal_0707         CDS       T01198                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nhl  Nitrosococcus halophilus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nhal_0707
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nhal_0707
   00650 Butanoate metabolism
    Nhal_0707
  Energy metabolism
   00190 Oxidative phosphorylation
    Nhal_0707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
713841..714170
Genome map
AA seq 109 aa AA seqDB search
MKGVMTGLRAWLVQRVTAVFMLVVLLLFFIRLVQDPFESYEEWQRWVGEPLISVLVTLFF
GALLLHAWVGLRDVILDYVHSTPLRLFAHSLVVIGYSGIAFWIVRILLR
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggggtaatgaccggcttgcgcgcctggttggtgcagcgggtgacggcagtgttt
atgctagtggtgttgttgcttttttttattcgcctagtgcaggaccccttcgaatcctac
gaggagtggcaacggtgggtgggggagccgttaataagcgttttggtgaccctttttttc
ggtgccttgttgctacatgcctgggtagggttgcgggatgtgattctcgattatgtgcac
tctacgccgctgcgcttatttgcccattctttggtcgtgatagggtatagtgggattgca
ttctggattgtcaggatattgttgagatga

DBGET integrated database retrieval system