KEGG   Nitrosococcus halophilus: Nhal_0726Help
Entry
Nhal_0726         CDS       T01198                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nhal_0726
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nhal_0726
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nhal_0726
Enzymes [BR:nhl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nhal_0726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
732221..733303
Genome map
AA seq 360 aa AA seqDB search
MPFRARYTGLIDKYRDRLPVHDDTRVISLGEGNTPLIRLNNIPRELGREVDIYVKYEGLN
PTGSFKDRGMTMAVTRAVEEGSRAIICASTGNTSASAAAYAARAGITAFVLIPEGKIAHG
KLAQAMMHGAIVIQIRGNFDRGMQLVKEVASKAPVTIVNSINPYRIQGQKTAAFEIIEEL
ECAPDFHCLPVGNAGNITAHWMGYSEYHAHGIVNTRPRMCGYQASGAAPFLEGKMVDQPE
TIATAIRIGHPQSWDKAWGAQQESQGWFSACSDEEILAAQKLLAEREGVFCEPASAAALA
GSIRDIEAGKIPGGSKIVCTLTGHGLKDPDTAIAQSKAPVVTVEASLESVQAAILENLES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcgagctcgttataccggcctgattgataaatatcgcgaccgcttgccggtc
catgacgatacccgggtgattagcttaggagaggggaataccccccttatcagattgaat
aatatcccccgagagttgggccgggaggtcgatatttatgtgaagtatgagggactcaac
ccaaccggttcttttaaggaccggggaatgaccatggccgtcaccagggctgttgaggag
ggcagtcgcgccattatctgcgcctctaccggcaacacttcggcctcggcagccgcctac
gcggcgcgagcgggaattaccgcatttgtccttattccggaaggtaaaattgcccatggc
aagcttgctcaggccatgatgcatggggctatagtgatccaaatcaggggtaattttgat
agggggatgcaactcgtcaaggaggtggcgagtaaggcgcccgtgaccattgtcaattcc
attaatccctatcggatccagggacaaaagacggcagcttttgaaattattgaagaactg
gaatgtgccccggatttccattgcctgccggtggggaatgcgggcaacattaccgcccat
tggatgggttacagtgaataccatgcccatgggatcgtcaatacccggccccgcatgtgt
ggctatcaggccagcggggcggccccctttctagaaggtaaaatggtggaccaaccggaa
accattgctaccgccatccgtattggccatccccaaagctgggataaggcttggggagca
cagcaggaatcccagggttggtttagtgcttgctctgacgaagagattctagccgctcaa
aaattgcttgccgaaagagaaggcgtgttttgcgagcccgcttcggcggctgctctagcc
ggatcgatacgggacattgaggctggcaagatacctgggggtagcaagattgtttgtacc
ctgactggccatggtctgaaggatccggatacggctattgcccagagtaaagcgcctgtg
gtgacggttgaagcgagcctagagtcggttcaagcggctatcttagagaatctggaaagt
tag

DBGET integrated database retrieval system