KEGG   Nitrosococcus halophilus: Nhal_0726Help
Entry
Nhal_0726         CDS       T01198                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00260  Glycine, serine and threonine metabolism
nhl00750  Vitamin B6 metabolism
nhl01100  Metabolic pathways
nhl01110  Biosynthesis of secondary metabolites
nhl01120  Microbial metabolism in diverse environments
nhl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nhal_0726
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nhal_0726
Enzymes [BR:nhl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nhal_0726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF5133
Motif
Other DBs
NCBI-ProteinID: ADE13906
UniProt: D5BX25
Position
732221..733303
Genome map
AA seq 360 aa AA seqDB search
MPFRARYTGLIDKYRDRLPVHDDTRVISLGEGNTPLIRLNNIPRELGREVDIYVKYEGLN
PTGSFKDRGMTMAVTRAVEEGSRAIICASTGNTSASAAAYAARAGITAFVLIPEGKIAHG
KLAQAMMHGAIVIQIRGNFDRGMQLVKEVASKAPVTIVNSINPYRIQGQKTAAFEIIEEL
ECAPDFHCLPVGNAGNITAHWMGYSEYHAHGIVNTRPRMCGYQASGAAPFLEGKMVDQPE
TIATAIRIGHPQSWDKAWGAQQESQGWFSACSDEEILAAQKLLAEREGVFCEPASAAALA
GSIRDIEAGKIPGGSKIVCTLTGHGLKDPDTAIAQSKAPVVTVEASLESVQAAILENLES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcgagctcgttataccggcctgattgataaatatcgcgaccgcttgccggtc
catgacgatacccgggtgattagcttaggagaggggaataccccccttatcagattgaat
aatatcccccgagagttgggccgggaggtcgatatttatgtgaagtatgagggactcaac
ccaaccggttcttttaaggaccggggaatgaccatggccgtcaccagggctgttgaggag
ggcagtcgcgccattatctgcgcctctaccggcaacacttcggcctcggcagccgcctac
gcggcgcgagcgggaattaccgcatttgtccttattccggaaggtaaaattgcccatggc
aagcttgctcaggccatgatgcatggggctatagtgatccaaatcaggggtaattttgat
agggggatgcaactcgtcaaggaggtggcgagtaaggcgcccgtgaccattgtcaattcc
attaatccctatcggatccagggacaaaagacggcagcttttgaaattattgaagaactg
gaatgtgccccggatttccattgcctgccggtggggaatgcgggcaacattaccgcccat
tggatgggttacagtgaataccatgcccatgggatcgtcaatacccggccccgcatgtgt
ggctatcaggccagcggggcggccccctttctagaaggtaaaatggtggaccaaccggaa
accattgctaccgccatccgtattggccatccccaaagctgggataaggcttggggagca
cagcaggaatcccagggttggtttagtgcttgctctgacgaagagattctagccgctcaa
aaattgcttgccgaaagagaaggcgtgttttgcgagcccgcttcggcggctgctctagcc
ggatcgatacgggacattgaggctggcaagatacctgggggtagcaagattgtttgtacc
ctgactggccatggtctgaaggatccggatacggctattgcccagagtaaagcgcctgtg
gtgacggttgaagcgagcctagagtcggttcaagcggctatcttagagaatctggaaagt
tag

DBGET integrated database retrieval system