KEGG   Nitrosococcus halophilus: Nhal_0726Help
Entry
Nhal_0726         CDS       T01198                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nhl  Nitrosococcus halophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nhal_0726
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nhal_0726
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nhal_0726
Enzymes [BR:nhl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nhal_0726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
732221..733303
Genome map
AA seq 360 aa AA seqDB search
MPFRARYTGLIDKYRDRLPVHDDTRVISLGEGNTPLIRLNNIPRELGREVDIYVKYEGLN
PTGSFKDRGMTMAVTRAVEEGSRAIICASTGNTSASAAAYAARAGITAFVLIPEGKIAHG
KLAQAMMHGAIVIQIRGNFDRGMQLVKEVASKAPVTIVNSINPYRIQGQKTAAFEIIEEL
ECAPDFHCLPVGNAGNITAHWMGYSEYHAHGIVNTRPRMCGYQASGAAPFLEGKMVDQPE
TIATAIRIGHPQSWDKAWGAQQESQGWFSACSDEEILAAQKLLAEREGVFCEPASAAALA
GSIRDIEAGKIPGGSKIVCTLTGHGLKDPDTAIAQSKAPVVTVEASLESVQAAILENLES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcgagctcgttataccggcctgattgataaatatcgcgaccgcttgccggtc
catgacgatacccgggtgattagcttaggagaggggaataccccccttatcagattgaat
aatatcccccgagagttgggccgggaggtcgatatttatgtgaagtatgagggactcaac
ccaaccggttcttttaaggaccggggaatgaccatggccgtcaccagggctgttgaggag
ggcagtcgcgccattatctgcgcctctaccggcaacacttcggcctcggcagccgcctac
gcggcgcgagcgggaattaccgcatttgtccttattccggaaggtaaaattgcccatggc
aagcttgctcaggccatgatgcatggggctatagtgatccaaatcaggggtaattttgat
agggggatgcaactcgtcaaggaggtggcgagtaaggcgcccgtgaccattgtcaattcc
attaatccctatcggatccagggacaaaagacggcagcttttgaaattattgaagaactg
gaatgtgccccggatttccattgcctgccggtggggaatgcgggcaacattaccgcccat
tggatgggttacagtgaataccatgcccatgggatcgtcaatacccggccccgcatgtgt
ggctatcaggccagcggggcggccccctttctagaaggtaaaatggtggaccaaccggaa
accattgctaccgccatccgtattggccatccccaaagctgggataaggcttggggagca
cagcaggaatcccagggttggtttagtgcttgctctgacgaagagattctagccgctcaa
aaattgcttgccgaaagagaaggcgtgttttgcgagcccgcttcggcggctgctctagcc
ggatcgatacgggacattgaggctggcaagatacctgggggtagcaagattgtttgtacc
ctgactggccatggtctgaaggatccggatacggctattgcccagagtaaagcgcctgtg
gtgacggttgaagcgagcctagagtcggttcaagcggctatcttagagaatctggaaagt
tag

DBGET integrated database retrieval system