KEGG   Nitrosococcus halophilus: Nhal_0742Help
Entry
Nhal_0742         CDS       T01198                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
nhl  Nitrosococcus halophilus
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:nhl00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
749835..750377
Genome map
AA seq 180 aa AA seqDB search
MSLLKIYHENDPNQVETYGGVEEIAKFMDGIGVCFQRWETPQSLAPEASQEEILAAYQAS
VDRLCREYGFKSADVISVKPDHPEKQALREKFLSEHTHSDFEVRFFVEGRGQFYLHAQGK
VYALLCEQGDFISVPAGLPHWFDMGENPNLKCIRLFTTPEGWVADFTGDDIADRFPRLGQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcctattgaaaatctaccatgaaaatgaccccaaccaggttgagacctatggggga
gttgaagagattgctaaattcatggacgggatcggagtgtgtttccaacggtgggaaaca
ccacagtctttggccccggaggcttcccaggaggaaatcctggcggcctatcaggcttcc
gtggaccggctgtgccgggaatacggatttaagtcagcggatgtgattagcgttaagcct
gatcatccggaaaagcaggcgcttcgggaaaaatttctgagcgagcatacccacagcgat
tttgaggtgcgctttttcgtggaagggcggggacaattttatctccacgctcagggtaag
gtgtacgccttgctatgcgagcagggggattttattagcgtgcccgcgggcctaccccac
tggtttgatatgggggaaaatccaaacttgaaatgtatccgactctttaccacaccagag
gggtgggttgccgattttaccggcgacgacattgcggaccggtttccccgcttgggtcaa
taa

DBGET integrated database retrieval system