KEGG   Nitrosococcus halophilus: Nhal_0746Help
Entry
Nhal_0746         CDS       T01198                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
nhl  Nitrosococcus halophilus
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Nhal_0746
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nhal_0746
Enzymes [BR:nhl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Nhal_0746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
753653..756043
Genome map
AA seq 796 aa AA seqDB search
MSVTAKSEAQRGPLAAEELRQIHAYWQACNYLAVGMIYLQDNPLLREPLKPEHIKQRLLG
HWGSSPGLSFIYIHLSRLIKKQDLNMIFLAGPGHGAPGVLAPVYLEGVYGEAYPNKGESE
EGMRRFFKEFSFPGGIGSHCTPETPGSIHEGGELGYSLSHAFGAAFDNPDLIAAVVIGDG
EAETGPLATAWHSNKFLNPIRDGAVLPVLHLNGYKINNPTLLARISHEELENLFQGYGWT
PYFVEGEDPELMHQAMAATLEQCVAEIRRVQEEARRRGIASRPRWPMIVLRSPKGWTGPK
EVDGHKVEGYWRSHQVPLSGMRDHPAHLQMLEEWMHSYQPEKHFDASGRLIPELKALAPV
GPRRMSANPHANGGLLRKALRLPDFRNYAVQVPKPGQMEVENTRPLGEFLRDIMENNPHN
FRVFGPDETTSNRLSAVYEASKKTWLADYLPEDADGGELAPDGRVMEMLSEHTLEGWLEG
YLLTGRHGVFATYEAFVHVIDSMFNQHAKWLDIAEDIPWRAPMSSLNLLITSTVWRQDHN
GFTHQDPGFLDLVVNKSPTVTRIYLPPDVNTLLSVADHCLKSSNDVNVIVADKQKHLQYL
DMDAAIKHCTKGIGIWDWASNDQGTEPDVVMVGCGDVATQEALAATALLRESFPDLKIRF
LNVVDLYTLTPAGEHPHGLSDRDFDSLFTVDRPIIFNFHGYPWLIHRLAYRRTNHRNLHV
RGYKEKGNINTPLELAIQNEVDRFSLAIDVINRIPALQVAGAHAKETLRDRQIECRNYAY
EYGTDKPEIRNWKWPL
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcacggcgaaatcggaggcgcagaggggtcccttagcagcggaagaactgagg
cagatccacgcttattggcaggcctgcaactaccttgccgtgggcatgatttatctccag
gataaccccttattgcgggagcctcttaagccggagcatatcaaacagcggctcctcggc
cactggggatcaagtcctgggcttagcttcatttacatccacctcagtcggcttatcaag
aagcaggatctcaacatgatctttcttgccgggccgggtcacggcgctcccggtgtgctg
gcgccggtgtacttagagggagtctatggagaggcctaccccaataaaggggagagcgaa
gaggggatgcgccgtttcttcaaggaattttccttccccggtggcattggcagtcactgt
acccccgagacccccggttccatccacgaggggggtgaactcggctatagcctctcccat
gcctttggcgccgcctttgacaatccggatctcatcgcggcggtggtgatcggggatggt
gaggctgaaacggggccgttagccaccgcttggcattccaataagttcctcaatcccatt
cgagatggggccgtcttgcctgtcctccatttaaacggctacaagattaacaatccgacc
cttcttgcccgcatctcccatgaggaattggagaacttgtttcagggctacggctggacc
ccttatttcgtggaaggggaggatccggagctgatgcaccaggcgatggcggcgaccctg
gagcagtgcgtagccgagatccgtcgggtccaggaagaagctcgccgcaggggtattgca
agccggccccgctggcccatgatcgtactccgcagtcccaagggctggaccggccccaag
gaagtggacgggcataaggtggaaggttattggcgctcccaccaggtgcctttgtccggc
atgcgggaccatccggcccatttgcaaatgctggaagagtggatgcatagctaccaaccg
gagaagcattttgacgccagtggtcggctcatccccgagttgaaggccctggccccggtg
ggaccccggcggatgagcgccaacccccatgccaatggtggcctgctgcgtaaagcgctg
cgcctacctgactttcgcaactacgctgtccaggtgccgaagccaggccagatggaggtt
gaaaacacccggccccttggcgagttcctgcgcgatattatggagaataaccctcataat
tttcgggtgttcgggcctgacgagacgacctccaatagattgagcgccgtctatgaagcc
agcaaaaagacgtggctcgcggattatctaccggaggatgccgatgggggggagcttgcc
cctgacgggcgagtaatggaaatgctctccgagcataccctggagggctggctggagggc
tatcttctcaccggccgccatggtgttttcgccacctacgaggcctttgtccatgtgatc
gactccatgttcaatcagcacgctaaatggctggatatcgccgaggatatcccctggcga
gcgccgatgtcctcccttaatcttctgatcacctccaccgtttggcggcaggatcacaac
ggctttacccaccaggaccccggtttccttgatttggtggtgaacaaaagtcccaccgtg
acccgtatctacctgccgcctgatgtcaacaccctgctcagcgtggccgaccattgcctc
aagagcagcaacgatgtcaacgtgatcgtggcggataagcaaaagcatttgcagtacctg
gatatggatgcggccatcaagcactgtactaagggtatcggtatttgggactgggccagc
aatgaccaggggacggagcccgatgtggtgatggtcgggtgcggtgatgtggccacccag
gaggccctggcggcgacggcgctgctgcgtgagtccttcccggatctcaagatccgcttt
ctcaacgtggtggacctttataccctcacccccgccggcgagcacccccacgggctttcg
gaccgggacttcgatagcctatttaccgtggacaggcctattatttttaatttccacggc
tacccctggcttatccaccgcctggcttaccgacgcaccaaccatcgcaacctgcatgtt
cgcggctacaaagaaaagggcaatattaacactcccctggaattggccattcagaacgaa
gtggaccgctttagcttggctatcgatgtcatcaaccgtatcccggcactccaggtggcg
ggcgctcatgccaaggaaacactgcgtgacaggcaaattgaatgccgcaactatgcttac
gagtatggtactgacaagccggaaatccgcaactggaagtggcccttgtaa

DBGET integrated database retrieval system