KEGG   Nitrosococcus halophilus: Nhal_0820Help
Entry
Nhal_0820         CDS       T01198                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nhl  Nitrosococcus halophilus
Brite
Enzymes [BR:nhl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Nhal_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
825700..826779
Genome map
AA seq 359 aa AA seqDB search
MRKIAFCLALAIGTTYTSHVLAGKNDGKLMEQAQSQFKPIPTEPPALEGNEVTPERIELG
KWLYFDPRLSKSWLISCNTCHNLALGGVDLEETSIGHGWAKGPRNAPTVLNSVFNLAQFW
DGRAEDLEAQAKGPIQAGVEMNNTPDRVERTLKSIPEYVQSFRKAFPGEADPVSFNNMAK
AIEAFEATLLTPGSPFDKYLKGDAGALSKAEKRGLKLFMDKGCSSCHSGVNLGGEGYYPF
GVVEKPGGEVLPEEDKGRFAVTKTASDEYVFKVPSLRNIELTPPYFHSGEVWELEQAVAI
MGSSQLGIDLNDNETAAIVTFLKTLTGEQPKVEYPILPPHTKGTPLPVVDVSSEAMMGH
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgctttttgcttggcgctagcaataggaaccacctacaccagtcatgtc
cttgcaggaaaaaacgatgggaagctgatggagcaggctcagtcccaatttaagccgatt
cccactgagccgccagccttagagggaaatgaggtgacgccggagaggatcgagcttggg
aagtggctatatttcgatcctcgcctttctaagagctggttgattagctgtaatacctgc
cataacctggcccttggaggggtagatctggaagagacttccattggccatgggtgggca
aagggaccccgtaacgctcctaccgtgcttaattccgtgtttaacctggcgcaattctgg
gatggacgggccgaggatctcgaagcccaggcgaaagggccgattcaggcaggggtagag
atgaacaatactccagatcgagtggagcggacccttaaaagcatcccagaatatgtccag
agctttagaaaggcctttcctggcgaggctgaccccgtctcttttaataatatggctaag
gccatagaagccttcgaggccactttattgaccccgggatccccctttgataaatacctt
aagggtgatgctggagcgctctccaaggcagagaaaagaggactaaaactttttatggat
aaaggttgttccagttgccacagtggggttaatctaggtggcgagggctattatcctttt
ggggttgtagagaaacccggtggtgaagtcctgccggaggaagacaaagggcggtttgcg
gtgaccaagacggccagtgatgagtatgtcttcaaagtgccttccttgcgcaatatagag
ctaactcctccctatttccattctggcgaggtatgggaactggaacaagccgtcgctatc
atggggtcgtcacaactgggcatagacctcaatgataatgagaccgcagccattgtgacc
tttttgaaaactttgactggcgaacagccgaaagtggaatatcctattctgccgcctcac
accaagggaacgccgctcccggtggtggatgtttccagcgaagctatgatgggacattaa

DBGET integrated database retrieval system