KEGG   Nitrosococcus halophilus: Nhal_0932Help
Entry
Nhal_0932         CDS       T01198                                 

Definition
thiol-disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nhl  Nitrosococcus halophilus
Brite
Enzymes [BR:nhl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Nhal_0932
Secretion system [BR:nhl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Nhal_0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944809..945546
Genome map
AA seq 245 aa AA seqDB search
MGRKLLGFLLTGVLVTFAFSAVGDEEKEAVRASLQKWAPGVQPQSIKAAPIPGIYEVVVE
GQVFYISQDGRYAMQGQLLDLANRTNLTEERLKVMRAAAIDGLDEQNMIVFGPEQAKHTV
NIFTDIDCGYCRQLHRHIDEYNELGIKIRYLAFPRAGIGSSSYDKAVEVWCAKDRHQAMT
QAKAGKPVENTAKCNNPVAEQFNLGQSLGVNATPTLILEDGSTLPGLVRPQNLVNILERK
IAAHP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaaaactattaggctttctgttaacaggggtgttggtaacctttgctttctcc
gcggttggggacgaagagaaggaggcggttcgggcatccctacaaaagtgggcaccgggg
gtgcagccccagagtatcaaagccgcgcctattcctggcatttatgaggtggtggtagag
ggacaggtcttttatatcagccaggatggccgctacgccatgcaagggcagctgcttgat
ctagcgaatcgaaccaacctgaccgaggaacggctgaaggtgatgcgggctgcggccatt
gatggtctcgatgagcaaaatatgattgtgtttgggcctgagcaggcaaagcacacggtg
aacatctttaccgatattgattgcggttactgccgccaattgcaccggcatatcgacgaa
tacaatgaattggggatcaaaatccgctaccttgcttttccccgtgccggtattggttct
tcatcctatgacaaagcggtagaggtatggtgtgccaaggatcgccaccaggccatgact
caggccaaagcgggcaagccggtggagaataccgctaagtgcaataatcccgtggctgag
caattcaatctcggtcaatccctaggagtcaatgctacccccactttgattctggaagat
ggttccaccttaccagggcttgtccgtccccagaatctggttaatatcttggagcgaaaa
atagcggctcatccttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system