KEGG   Nitrosococcus halophilus: Nhal_0995Help
Entry
Nhal_0995         CDS       T01198                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
nhl  Nitrosococcus halophilus
Brite
Enzymes [BR:nhl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Nhal_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
985405..985821
Genome map
AA seq 138 aa AA seqDB search
MEDLFQQLKRHEGLRLKPYRDTVGKMTVGYGRNLEDRGISEQEAELMLMNDVLHFQSRLS
QYSWFLVMNETRQGVIINMAYNLGMGGLLSFKRMIAALGDRNYTLAACEMVDSLWAKQVG
NRAAELAEQMRLGWRIPF
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggaagacctcttccagcaactcaagcgccatgagggcctgcggctcaagccttaccgg
gacacggtaggcaagatgaccgtgggttatggccgcaatttggaggaccggggcatctcc
gagcaagaagcggagctgatgctgatgaacgacgttctccattttcagtcccggctatca
caatattcctggttcctggtcatgaacgaaacccgccagggggtcattatcaacatggcc
tataacctggggatgggcggtctgctcagcttcaagcgcatgatcgccgccctgggagat
cgcaattacaccctggcggcttgtgaaatggtggattcactttgggcgaaacaagtgggg
aaccgcgccgcggagctggccgagcaaatgcgcctgggctggaggattcccttttga

DBGET integrated database retrieval system