KEGG   Nitrosococcus halophilus: Nhal_1059Help
Entry
Nhal_1059         CDS       T01198                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nhl  Nitrosococcus halophilus
Brite
Enzymes [BR:nhl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Nhal_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1046712..1047284
Genome map
AA seq 190 aa AA seqDB search
MEAMKAVPRYEFVPDELRPYAYDNGPLAIGHGQTISQPYIVALMTDLLEPAPDDIILEVG
TGSGYQVAVLSKLVKKVYTIEVIEELAQQAEARLWRLGYTNVEARVGDGYFGWPEQAPFD
GIIVTAAAPSIPAPLIEQLKVGARLVLPLGVSFDQELMVIEKKENNEIDTRSIFRVSFVP
LTGEHQEYSP
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggaggccatgaaagccgtgccgcgctatgaatttgtgccggatgagctccgtccctat
gcctatgataatggcccccttgctattgggcatggacagaccatttcccaaccctatatc
gtcgctttaatgactgatcttttagaacccgcccccgatgatatcatcctggaggtaggc
acaggttcgggataccaggtggcggttctctctaagctagtcaaaaaagtttacactatt
gaagttattgaggaattagcccaacaagcagaggctcggttgtggcggctgggttatacc
aatgtcgaagcccgagtcggcgatggttattttgggtggccggagcaggcgccctttgat
ggaatcatagtgactgcggcggcaccttctattccagcgccactgattgagcagctcaag
gtaggtgcacgattggtgcttcccctgggagtgagctttgatcaagagcttatggtgata
gaaaagaaggaaaataacgaaatcgatacacgtagtatattcagggtatcttttgtgcct
ttaaccggagagcatcaggaatattccccctaa

DBGET integrated database retrieval system