KEGG   Nitrosococcus halophilus: Nhal_1071Help
Entry
Nhal_1071         CDS       T01198                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nhl  Nitrosococcus halophilus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nhal_1071
Enzymes [BR:nhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Nhal_1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1061208..1061684
Genome map
AA seq 158 aa AA seqDB search
MVRAYIGLGSNLNQPQEQVCQALAELAALPQTRRVAHSKLYRSAPMGPQDQPDYINAVAV
LDTGLGPFDLLAKLQAIEQSHHRVRKRHWGERTLDLDLLLYGDLEIATEKLTIPHSQLHE
RAFVLYPLAEVAPQVVVPGRGRVVDLAQCCSPQGLQRL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggttcgagcttatattgggttaggaagcaatcttaaccagcctcaggagcaagtttgt
caagccctggctgagctcgctgctctgccccaaacccgccgtgtagcccattctaagctc
taccgaagcgctccgatggggcctcaagatcaaccggattatattaatgcagttgcggtc
ctggacacggggctgggaccttttgacttgctagctaagctgcaagctattgagcagagc
catcatcgagtccgcaagcgccactggggtgagcgcactttggatctcgatttgctcttg
tacggtgacttagagattgcgacggagaagttgaccataccccattcccaattgcatgag
cgggcctttgtgctctatcccttagcagaagtcgccccccaggtggtggtccctgggcga
ggaagggtggttgatcttgcccagtgctgttcccctcagggcttacaacggttatga

DBGET integrated database retrieval system