KEGG   Nitrosococcus halophilus: Nhal_1097Help
Entry
Nhal_1097         CDS       T01198                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00500  Starch and sucrose metabolism
nhl01100  Metabolic pathways
nhl01110  Biosynthesis of secondary metabolites
Module
nhl_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nhal_1097
Enzymes [BR:nhl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Nhal_1097
Exosome [BR:nhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nhal_1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ADE14269
UniProt: D5BZ56
Position
complement(1086187..1088436)
Genome map
AA seq 749 aa AA seqDB search
MTDSQYSAQPRAPELSEELKKIVKARHPDPFKVLGCHPHGKGILVRVHLPHATQAWVGTE
GTREMVRSSTTGLFEWHGEVKELSPPYQILWKDERGTTHRGYDPYCFPPQLSDYDLHLFR
EGKHWHAYRILGSHPVTVNGISGILFATWAPEAERVSVVGDFNRWDGRCHPMRLRGLTGV
WELFIPGLKPGTLYKYELRNQNYGSLHLKSDPYAQHFELRPNTAAIVESKNSYLWRDQKW
MLQRKKFNWLHQPISVYEVHLGSWQRDENGKFLNYRQLAWRLVDYVLNIGFTHIELLPVT
EHPLDASWGYQTTGYFAPTSRFGTPDEFRYFVDYCHLHGIGVLMDWVPGHFPKDDHALAR
FDGSALYEHEDPRRGEHRDWGTLIFNYGRHEVKNFLLSSAFYWLEEFHIDGLRVDAVASM
LYLDYSREEGDWIPNKYGGREDLEAIEFLRELNTVLHEQHPGALVIAEESTSWPMVSRPV
YLGGLGFSMKWNMGWMNDTLLYMSKDPIHRHYHHDALTFGLLYAFNENFMLPLSHDEVVH
GKKSLLYKMPGDEWQRFANLRLLYTMMFTYPGKKLLFMGCEFGQGEEWNESRTLDWYLLE
YPFHQGVQMAIRDLNRLYYGLPALHDHDFEKEGFEWIDCHDSAQSILSYLRLKEDDFVVV
VLNFTPVPRTNYRLGVPKAGTYSECFNSDSTYYGGSNIGNNQGIQAEEISWMGRPYSINI
TVPPLAGIVLQPKPLTKEEPSIPSLNPKK
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattctcagtattccgcgcaacccagggctcctgaactctcagaggagcttaaa
aagatcgtaaaggcccgccatcccgatccctttaaagtactaggctgccatccccacgga
aaaggcatcctggtacgggtccatctcccccatgccacccaggcctgggttgggaccgaa
ggcactcgggaaatggtgcggtcttcaacaacgggtttattcgaatggcatggagaggtc
aaagaactctcccccccctatcagattttatggaaggatgagagagggacgacccatcgc
gggtacgacccctactgcttccctccacaactttccgattacgatctccaccttttcagg
gaaggcaaacactggcacgcctaccgtattctgggctcccatccagtgactgtgaatggc
atcagtggcattttgtttgccacctgggcccccgaagctgaacgggtaagcgtggtagga
gatttcaaccgctgggacggtcgctgccaccccatgcgacttcggggcctaaccggagtt
tgggagctgttcatccccggtttgaaaccaggcaccctctataaatacgagctccgtaac
cagaattatggatccctccatcttaagtccgatccttacgcgcaacatttcgaactacgt
cctaatacggccgctattgtagagtcaaaaaacagctacctgtggcgggaccaaaagtgg
atgctccagcgcaagaaattcaattggctccatcagccgatttcagtctatgaggtccac
ctcggatcctggcaacgggatgaaaacggcaaattcctcaattatcgccagctagcctgg
cgattagtagattatgtcttaaacattgggtttacccatattgagcttctaccagtgact
gaacaccccttggatgcctcttggggttatcaaacaacaggttatttcgcgccgacgagt
cgcttcggcacacctgatgagttccgatactttgtggattattgtcacctccatggcatt
ggcgtgctcatggattgggtgcctgggcattttcccaaggatgaccacgccttagcccga
tttgatggcagcgccctctacgaacatgaagatccccgtcgtggagagcatagagactgg
ggaacgcttattttcaactacggtcggcatgaagttaagaatttcctgctttcttccgcc
ttctattggctcgaagagttccatattgacggcctacgggtagatgcagtggcttcaatg
ttatatctagactattcccgggaggagggagattggatacctaataaatatggggggcgc
gaagatcttgaggctatcgagtttctacgggagctgaataccgtacttcatgaacagcat
ccaggcgccttggtcatcgctgaagaatccacctcctggcctatggtctcgcggccagtc
tatcttgggggccttggcttttccatgaaatggaatatgggctggatgaatgacactcta
ctctatatgagcaaagatcccattcaccgtcattatcatcacgatgccctgacctttggg
ctgctatatgcctttaacgaaaactttatgttgcccctctcccatgacgaagtcgtccat
ggaaagaaatccttactttacaagatgccgggggatgagtggcaacgatttgctaatctc
cgcctgctctataccatgatgttcacctacccaggtaagaagttgttattcatgggctgt
gagtttggacaaggtgaggaatggaacgagtcccgaaccctggactggtacctgctagag
tatcctttccaccagggggtgcaaatggccatcagagacctcaaccgcctctattatggc
ctccctgccttacatgaccatgatttcgagaaggaaggctttgaatggatcgactgccat
gattctgcccaatcgatcttgagctacctacgcctaaaagaggacgattttgtggtcgtg
gtgttaaattttacccctgtcccccggactaattaccgtctcggggttcctaaagccggc
acctattcagagtgcttcaattcggattctacctactatggcggcagcaatatcggcaat
aaccaaggcatccaagccgaggagattagctggatgggacgtccctattccatcaacatt
acggtgcctcctttagcgggaatcgtattgcaaccgaaacctctaaccaaggaggagccc
tctatcccgtccctcaatcccaaaaaataa

DBGET integrated database retrieval system