KEGG   Nitrosococcus halophilus: Nhal_1099Help
Entry
Nhal_1099         CDS       T01198                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
nhl  Nitrosococcus halophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nhal_1099
Enzymes [BR:nhl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Nhal_1099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1090100..1091548
Genome map
AA seq 482 aa AA seqDB search
MVKAEPFRQRHGGILLHVTSLPSSDLGADAYRFVDFLAEAGITVWQVLPLGPTHEDLSPY
QCLSVHAGNPKLISLQALVEEPWFGVCDADLADRKAVLQQGCRRFAIYANQAMQAEFTAF
CRDQAFWLEDYVLFQALRETYGNTPWFEWPQKLRRREEQVLKAAGQELGTLMDRNRFEQF
IFFRQWSRLKNYANWHGILIFGDMPIFVAHDSADVWAQPEYFTLDKDGQLTVMAGVPPDY
FSATGQRWGNPLYQWDAIEADGFCWWLGRMRTQLKLCDIIRIDHFRGFESYWEISADAET
AVKGRWIKAPGEALFHTLEAYYGALPLVAEDLGTITPEVEVLRDQFHLPGMKVLQFAFDG
GSDNPYLPENHVENCVVYTGTHDNDTILGWFNRLSEEKRHWVYECLGFPAEPMPWALINC
AFQSVARHAVVPMQDILELGSEGRMNLPGTIEGNWRWRFNWSQIKPDLAARVRRLVERYD
RL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaaggctgagccatttcggcagcgacatggggggattttgctccatgttacgtct
ttgccgagtagcgatctaggggcggacgcttaccgtttcgtggattttcttgcggaagcg
ggtattacggtttggcaggtccttcctttagggcctacccacgaggatctatccccctat
caatgcctctcggttcatgccggtaatccgaaattaatttccttgcaggccctggttgag
gaaccctggtttggggtctgtgatgctgacttggccgatcgtaaggcggtgctacaacag
gggtgtcgccgctttgctatttatgcaaaccaggcgatgcaggctgaatttacagcattt
tgccgggatcaagctttttggttggaagactatgttctatttcaagccctgcgggaaacc
tatggtaataccccttggtttgaatggccccaaaaactgcgcaggcgggaagaacaggtg
cttaaagcggcaggccaagagctagggactttgatggaccgtaaccgctttgagcaattt
attttttttcggcagtggtcgagactcaaaaattatgccaattggcatgggatattgatc
ttcggtgatatgcccatttttgttgcccacgatagtgctgatgtttgggctcaaccagaa
tattttactttggataaggatggccagttgacggtgatggcaggggtgcctcctgattat
ttttcggcaactggccagcgttggggaaatcccctctaccagtgggatgccattgaagcc
gatggattttgttggtggctagggcgaatgcgcacccagttaaagttatgcgatatcatc
cgcattgatcacttccgcggctttgaatcctactgggagatttctgctgatgctgaaaca
gcggttaaggggcgatggataaaagcacctggcgaagctctatttcacaccttggaggct
tactacggggctctaccgttggtggctgaggatttaggcaccattactccagaggtggag
gtgttgcgggatcaatttcatttgcctgggatgaaagttttacaatttgcttttgatggc
ggatctgataacccttatcttcctgaaaatcacgtggaaaactgtgtggtgtatacgggt
acccacgataacgataccatcttaggttggtttaatcgcttgtctgaagagaaacgccac
tgggtctacgagtgcctaggatttccagccgagcctatgccatgggcgctgattaattgt
gcctttcagtcagtagcacggcatgctgtcgtgccgatgcaagatattttggagttaggg
agcgaggggcgcatgaatttaccgggaacgattgagggtaattggcgctggcgttttaat
tggtcacagataaaaccggatcttgcggcacgggtacgtcgcttggttgagcgctatgat
cggttatga

DBGET integrated database retrieval system