KEGG   Nitrosococcus halophilus: Nhal_1211Help
Entry
Nhal_1211         CDS       T01198                                 

Definition
(GenBank) Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00010  Glycolysis / Gluconeogenesis
nhl00020  Citrate cycle (TCA cycle)
nhl00620  Pyruvate metabolism
nhl01100  Metabolic pathways
nhl01110  Biosynthesis of secondary metabolites
nhl01120  Microbial metabolism in diverse environments
nhl01130  Biosynthesis of antibiotics
nhl01200  Carbon metabolism
Module
nhl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nhal_1211
   00020 Citrate cycle (TCA cycle)
    Nhal_1211
   00620 Pyruvate metabolism
    Nhal_1211
Enzymes [BR:nhl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nhal_1211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADE14373
UniProt: D5BZS8
Position
complement(1205312..1206436)
Genome map
AA seq 374 aa AA seqDB search
MNRIFKLPDLGEGLTDAEIVEWHVKVGDEVKMDQPLVAVETAKAIVDIPSPYQGRIDKLY
GESGDIIHVDDPLVEFETEGAQPQPEKREDTGTVVGKVETGKEVVQETATRVGQVPSGIK
ATPAVRALAHRLDVDLSIVTPTGADGMVTATDVQRVAKILAEVGPLEPLRGVRRTMARAM
ATAHAEVVPVTVNDDADIQAWSPEEDITLRLIRAIVTACQAEPALNAWYDSHAIGRRILK
KIDLGIAVDTPDGLFVPVLRDVGNREPANLRQGLDAIKQAVRERKLPPEELRGYTFTLSN
FGTFGGRYADPVVIPPTVAILGAGRLHEAVVPVNGKPEIHRILPLSLTFDHRSVTGGEAT
RFLMVAIQDLEKAE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtatctttaagcttcctgatttgggggaagggttgaccgacgctgaaatcgtc
gaatggcacgttaaagtcggcgatgaggtcaaaatggaccaacccttagtggcggtggaa
acggccaaggccatcgtggacattccgagcccttaccagggccgcatcgacaagctatat
ggagaatccggggatatcatccacgtggatgatcccctggtggaattcgaaaccgaaggg
gcccaaccccaaccggaaaagcgggaggatacgggcacggtcgtgggcaaggtggaaaca
ggcaaggaggtggtccaagaaaccgccacccgagtagggcaggttccttcaggcattaag
gccactcctgccgtgcgtgccctcgcccaccgcctggacgtggatctctccattgtcacc
cccacgggtgctgatggcatggtcaccgccacagacgtccagcgggtagcaaagatactg
gctgaggtgggtcccctggaacccttgcggggagtccgccgaaccatggctcgagccatg
gccaccgcccatgcggaagtggtcccggtcaccgtcaatgatgatgcggatatccaggcc
tggagcccggaggaagacatcaccctgcgccttatccgcgccattgtcactgcctgccaa
gcggaacccgcccttaatgcctggtatgacagtcatgccatcgggcggcggatactcaag
aaaattgatctcggcattgccgtcgatacccccgatgggctttttgtaccggtcctgcgg
gatgtgggtaaccgtgagccggccaatcttcgccaaggactcgatgccatcaagcaggcg
gtgcgggagcgtaaactcccacccgaagaattacggggctatacctttaccctctccaat
ttcggcacctttggcggacgctacgccgatcccgtggtaataccgcctaccgtcgccatc
ctaggcgcgggccgtctccatgaggcggtggtccccgtcaacggcaaaccggaaatacac
cgcattcttcctttgtcattaaccttcgatcaccgctcggtcaccggcggtgaagccacc
cgctttctgatggtggccattcaggacctggaaaaggccgagtaa

DBGET integrated database retrieval system