KEGG   Nitrosococcus halophilus: Nhal_1338Help
Entry
Nhal_1338         CDS       T01198                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
nhl  Nitrosococcus halophilus
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1337457..1339178
Genome map
AA seq 573 aa AA seqDB search
MADNGAFEAVVVGSGFGGAITACRLSKKWPGKVLVLERGKRYPMGAFPRTPHEVGRNFWN
LSSESRSRPKRLPKLDLHGMFDIRTFGHMDAVLCAGLGGGSLIYANVFMEPPDEVFAQGW
PESCKKYTLRPYYQLVKAVLGARPIPASNDPRRRIRRTKLFQKLAKEQGKDSQLVDINVF
FGNDFAHPTPIGTQERNRYGALQTSCVYCAECDVGCNTHSKNTLDLNYLFVAENRYEAKI
STEHLVEKIVPVAENGADDPHADGDYGYRVYYRDLNSQKECSVFTRRVIVAAGTLGSNEL
LLRCRDVFKTLPNINKNLGQGFSGNGDFLSFVIEGKEPADPNYGPVITQRTDYNLFGHFD
RERAFILEDASYPAFAAWYVEGIRPRLSHFSAIVKIIQQAFRRWFLGKSMGRIGDTFHDL
LGNEVSYQSSVLLCMGLDRGNGTMTLSQDGYVQIHWPYRDSLSLYRAMLKAGKHFRKQVG
AKAFVPLPNWWWPFRRNITVHPLGGCRLAENPGEGVTSAKPEELGQVFGYKGLYVADGSI
VPTAVGANPIATISALAERVAEGITGIKPDPDL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggctgataatggtgcttttgaagccgtggtggtaggtagtggatttgggggtgctatc
acggcctgtcggctgtcaaagaagtggcccgggaaagtactggtattggagcgtgggaag
cgctatcccatgggtgcttttccgcggacgccccatgaggtggggagaaatttctggaat
ctttcttccgaatcccggtcacggccaaaacgccttcccaagcttgacttgcatggaatg
tttgatatccgcactttcggtcatatggatgctgtgctctgcgcgggcttggggggtggc
tcattgatttacgccaatgtattcatggaacccccagacgaagtgttcgcgcaggggtgg
cctgaaagttgcaagaagtatacgctgcgcccctattaccaattagtaaaggccgtattg
ggggcccggccaatcccggcaagtaatgatcctcgccgccgtatccgccggaccaagctg
ttccaaaagctggccaaagagcaaggaaaagattcccagttggtggatattaatgtgttt
tttggcaatgattttgcccatcctacccccattggcactcaagaaagaaatcgttatggg
gctttacagacttcctgtgtgtattgtgctgaatgtgatgtgggatgcaatactcattcc
aagaataccctggatctcaactatttgtttgtggctgaaaatcgttatgaagccaaaatt
tccaccgagcatttagtggaaaaaattgttcctgtggccgaaaacggggctgatgatccc
catgccgatggtgattatggatatcgtgtctattaccgagacctcaatagccagaaagaa
tgctctgtattcacccgccgagtcattgttgccgccggtaccttgggttccaatgaatta
ttgttacggtgccgggatgtgtttaagactctgccaaacatcaataaaaacttaggacaa
ggattttctggcaatggagattttttatcctttgtgattgaaggtaaggagcctgctgat
cctaattatggccccgtcatcactcagcgtaccgactataatttgtttggtcactttgat
cgagaacgggcttttattcttgaggatgccagctatcctgcctttgctgcctggtatgta
gaaggcattcgtccccgtttgtcccacttctcagcaatcgtaaagatcattcaacaggcc
tttagacgctggttcttgggtaaatccatggggcggattggggacacttttcatgatcta
ctgggcaatgaggtctcttaccagagcagtgtgctgttgtgcatggggctggatcggggc
aatggcacaatgacacttagtcaggatggctatgtgcaaatacattggccgtaccgggat
agcctctctttatatcgagcaatgctgaaagcagggaagcattttcgcaagcaagtcggt
gctaaagcatttgtccccttgcccaactggtggtggccctttcgtagaaacatcacggtc
catcctctgggcggttgtcggctggcagaaaatcctggagagggggtcaccagtgccaag
ccggaggaattgggccaagttttcggctataaaggattgtacgtagctgacggctcgatc
gtgcccactgccgttggggctaatcccattgccaccatatctgcgttagcggagcgggtg
gcggaaggaattacgggtatcaagcctgatcccgatctatag

DBGET integrated database retrieval system