KEGG   Nitrosococcus halophilus: Nhal_1347Help
Entry
Nhal_1347         CDS       T01198                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
nhl  Nitrosococcus halophilus
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Nhal_1347
Enzymes [BR:nhl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Nhal_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1353128..1354705
Genome map
AA seq 525 aa AA seqDB search
MSAHFDAIVVGTGFGGAITACRLAQAGARVLVLERGRRWTPETYPRKLQDPWFYHPSHPQ
KHSGWLDLRFFRGMAVAQGAGVGGGSLCYSSVVMEADADCFMEGWPPEITYEELRPYYDK
VRRMLALGSIPEGQHTHRFQLLRRAAEELGYRDRFEAVPLAISFDPEYSYDLPNPIDAKH
SKSFVNSQGVRQGTCVHLGNCDIGCDVKAKNTLDLNYVPEAEQHGAEVRPLHLVRHVEPA
GTGYRVVWDEVRDGKLVRGSAEADRVVLAAGSLGSTEILLRSRDEAKTLPAVSRQLGVDW
SANANFLTPAIYPKGVDVNQGIGPTISAGLRFMDSEVNGQRFYIEDDGFPNLLLNAAASR
LGSGFLGRLLHNLLRRGLDEKNPTAQVMVWLGEGLDAADGRLHLGRSWLKPWQRKLKLDW
EVEESRAVIDAIIDIHRQLSEVDGGRLKVPFYWRVLRNLVTVHPLGGCRIGGSAEDGVVD
HRGQVFGYPNLYVVDGALLPKPTGRNPSMTIGALAERMADLMTQN
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgcacttcgatgctattgtggtcggcacgggctttggtggcgccatcaccgcc
tgccgtttggctcaggcaggcgcacgcgtattggtgctggagcgcggtcgacgctggact
ccagagacctatcctcggaaactccaagatccctggttttaccacccaagccatccccag
aaacacagcggttggttagacctgcgcttcttccggggcatggcggtagcccagggcgcc
ggtgttggcggggggtcactatgctactccagcgtggtgatggaagcggacgctgactgt
tttatggaggggtggccgccggagattacttacgaagaactccgtccttactatgataag
gtgcgccgcatgcttgccctgggctcaatcccagaagggcagcacacccaccgttttcag
ttgttgcggcgggcggcggaggaactgggctacagggatcgctttgaggcggtccccttg
gctatctcttttgatccagaatatagctacgatttacctaaccccatcgatgcgaagcat
tccaagtcttttgtcaattcccagggggttcgtcagggcacttgtgtgcacctaggcaac
tgcgatattggatgtgatgttaaggccaaaaatacgctcgatctcaattatgtgccggaa
gcggagcagcacggggccgaggtacggccactgcacctggttcgccatgtggagcctgcc
gggacgggttaccgggtagtgtgggatgaagtacgggatggaaaattggtgcgtggttcg
gcggaagccgaccgggtggtattagccgctggttctttaggttctaccgaaatcttattg
cgcagtcgcgatgaggccaaaactctgcctgcagtgagccggcaattgggtgtcgactgg
agcgccaacgccaattttctgacccccgctatttatccaaagggagtggatgtcaatcag
gggattgggccaactatctctgctggtctccgctttatggatagcgaggtgaacgggcag
cgtttctatatcgaagacgatggctttcccaacttgttgctcaatgctgctgcttcccgg
ttaggcagcggcttcttggggagactgttgcacaaccttctaaggcgtggtctggacgag
aaaaatcctaccgctcaggtgatggtgtggctgggtgaaggtctggatgccgctgatggt
cgactccacctaggacgctcctggctcaagccttggcagcggaaacttaagttggactgg
gaggtggaggagtcgcgggcggtcattgatgccatcatcgacatccatcggcagttatcg
gaagtggatggtggccggctcaaggttcccttctactggcgggtgttgcgcaatctagtt
accgttcaccccctgggaggatgccgtattggcggcagtgcagaggatggagtggtagat
catcggggtcaggtgtttggttatcccaatctttatgttgtcgacggcgctctcctgcca
aaacccacaggccgcaatccctcaatgaccattggtgctctagcggagcgaatggcggac
ttgatgacccaaaactaa

DBGET integrated database retrieval system